KEGG   Helicobacter pylori XZ274: MWE_0756Help
Entry
MWE_0756          CDS       T02130                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hey  Helicobacter pylori XZ274
Pathway
hey00473  D-Alanine metabolism
hey00550  Peptidoglycan biosynthesis
hey01100  Metabolic pathways
hey01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hey00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MWE_0756 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MWE_0756 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    MWE_0756 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hey01011]
    MWE_0756 (ddl)
Enzymes [BR:hey01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MWE_0756 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:hey01011]
 Precursor biosynthesis
  Amino acid ligase
   MWE_0756 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A ATPgrasp_TupA RimK ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AFJ81609
UniProt: I2DFU3
LinkDB All DBs
Position
complement(678654..679562)
Genome map
AA seq 302 aa AA seqDB search
MVEESNMHSKYFAQIKEKKLPPLILTHNGLLKNSFLGTKIIELPLVINLVHGGDGEDGKL
ASLLEFYRIAFIGPRIEASVLSYNKYLTKLYAKDLGVKTLDYVLLNEKNRANALNLIGFN
FPFIIKPSNAGSSLGVSVVKEEKELVYALDGAFEYSKEVLIEPFIQGVKEYNLAGCKIKK
DFCFSYIEEPNKQEFLDFNQKYLDFSRNKAPKANLSNTLEEQLKENFKKLYNDLFDSALI
RCDFFVIENEVYLNEINPIPGSLANYLFDDFKTTLENLAQSLPKTPKIPIKNSYLLQIQK
NK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
ttggttgaagaatccaacatgcattcaaaatacttcgctcaaatcaaagaaaaaaaatta
ccccccctaatccttacgcataatggcttgcttaaaaactcgtttttaggcactaaaata
atagaattgcctttagtgatcaatcttgtgcatgggggcgatggcgaagatgggaaatta
gcgagcttgttagaattttatcgtatcgcttttataggccctaggattgaagcgagcgtg
ttgagttataacaaatatttaaccaagctttacgccaaagacttaggggtcaagacttta
gattatgttcttttgaatgaaaaaaaccgcgctaacgctctaaatttgattggctttaat
tttcctttcataatcaaacctagtaacgctggtagctctttaggggtgagcgttgtgaaa
gaagaaaaagaattggtttacgctttagacggcgcgtttgaatattctaaagaggtttta
atagagcctttcattcagggagtgaaagaatacaatttagccggttgcaagatcaaaaag
gatttttgtttttcttatattgaagagcctaacaaacaggaatttttagatttcaaccaa
aaatatttggatttttcacgcaataaagcccccaaagcaaatctttctaacactctagaa
gaacaattgaaagaaaattttaaaaagctctataacgatttgtttgatagcgcgctcatt
cgttgcgatttttttgtcatagaaaatgaagtgtatcttaatgagatcaaccccattcct
ggcagtttggccaattatttgtttgatgattttaaaacaacgctagaaaatttagcgcaa
tcattacccaaaacccctaaaatcccaatcaaaaactcttatttgttgcaaatccaaaag
aataagtaa

DBGET integrated database retrieval system