KEGG   Helicobacter pylori XZ274: MWE_1097Help
Entry
MWE_1097          CDS       T02130                                 

Definition
(GenBank) ABC-type polar amino acid transport,periplasmic component
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
hey  Helicobacter pylori XZ274
Pathway
hey02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hey00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MWE_1097
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hey02000]
    MWE_1097
   02035 Bacterial motility proteins [BR:hey02035]
    MWE_1097
Transporters [BR:hey02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter
    MWE_1097
Bacterial motility proteins [BR:hey02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    MWE_1097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Phosphonate-bd Lig_chan-Glu_bd
Motif
Other DBs
NCBI-ProteinID: AFJ81872
UniProt: I2DGK6
LinkDB All DBs
Position
complement(1017376..1018152)
Genome map
AA seq 258 aa AA seqDB search
MKKVLFLFLLVISFFEGFLNASSLYERLVNKETISVGTEGIYPPFTYHNKEGKLTGYDVE
VARELAKELGVKIKFHETSWDIMLTGLKSGRFDMVANQVSLTTKKRQATFDKSLPYSYSG
TIMLVRKDENRIKDIKDIKGLRAANTLSSTYGEIAFKYDAQIVSVDSMAQALLLVAQKRA
DLTLNSSLAILNYLNTHKNNPFKIAWESKEKDGGASFVINKHQEKALELINQAMQRLIDK
GVLKRLGEQFFGKDVSQP
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttttatttctctttttactggtaataagcttttttgagggttttttgaac
gcttctagcttgtatgaaaggcttgtcaataaagaaacgatcagcgttggcacagaaggc
atttacccccctttcacttaccacaataaagaaggcaagctcaccggctatgatgtggaa
gtggctagggagttggctaaagagcttggcgtgaaaatcaaattccacgaaacttcatgg
gatattatgcttacaggcttgaaatcggggcgttttgatatggtcgctaatcaggtgagt
ttgacgactaaaaaacgccaagcgacttttgataaaagcttgccctatagctattcagga
acgatcatgctggttagaaaagatgaaaaccgcattaaagacattaaagacattaagggt
ttgagagcggctaacactttaagctccacttatggggaaatcgctttcaaatacgacgct
caaatcgtttcggtggattctatggcgcaagctttgttgttggtggcgcaaaaacgggcc
gatttgaccttaaatagttctttagcgatcttaaactacctaaacacccacaaaaacaac
ccctttaaaatcgcatgggaatccaaagaaaaagatgggggcgcttcctttgtcatcaac
aagcaccaagaaaaagccttagagcttatcaaccaggcgatgcaaagattgatagataaa
ggggttttaaaacgcttgggcgaacaattttttggaaaagatgtcagccagccataa

DBGET integrated database retrieval system