KEGG   Helicobacter pylori XZ274: MWE_1098Help
Entry
MWE_1098          CDS       T02130                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hey  Helicobacter pylori XZ274
Pathway
hey00473  D-Alanine metabolism
hey01100  Metabolic pathways
hey01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hey00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MWE_1098
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    MWE_1098
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hey01011]
    MWE_1098
Enzymes [BR:hey01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MWE_1098
Peptidoglycan biosynthesis and degradation proteins [BR:hey01011]
 Precursor biosynthesis
  Racemase
   MWE_1098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AFJ81873
UniProt: I2DGK7
LinkDB All DBs
Position
complement(1018223..1019362)
Genome map
AA seq 379 aa AA seqDB search
MGMLKRASFVEVNSASLRHNFSTVKSIVSKDAHIMAVVKANAYGAGAIKASEIFLQEGAH
YLGVATLDEALELRSHFSKTPILILGYSPNSNASMLIDNDLSTMIFSLEQAEVFSQMALK
SQKRLKVHLKIDTGMHRLGLEPNFKSIETIKKIRALKGLEVEGIFTHLSNADAKIKTHAK
NQMKAFNAFLEQLLNQKIEFQYRHAYNSAGILSLCNGNENRFLNLYRPGIMLYGFYPSNG
MKETCPTILKNVISLKAQIVQIRSVKKGEFIGYGEHFYTNEETLVGVLALGYADGLMRAL
GNRIQVAINNQLAPLIGKVCMDQCFVKLNNIQAKEGDEVILFGDKSAKANDASEIAALLN
TIPYETISTLSKRLERVYI
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgttaaaaagggcgagttttgtagaagtgaatagcgcttctttaaggcataat
tttagcacagtcaaaagcattgtctctaaagacgcccatatcatggcggttgtcaaggcg
aacgcttatggggcaggagccataaaagcgagcgaaattttcttacaagaaggggcacat
tatttaggggtagcgaccttagatgaagctttagagttgcgctctcatttttctaaaacc
cccattttgattttaggctatagccctaattctaacgcttccatgctgattgataacgat
ttgagcactatgatttttagccttgaacaagcggaagttttttctcaaatggctttaaag
tctcaaaaacgcttaaaagtgcatctcaaaattgataccggcatgcaccgcttgggatta
gagcctaattttaaaagcatagaaaccattaaaaaaatccgcgctttaaaaggcttggag
gtggaagggatattcacgcatttaagcaacgctgatgctaagattaaaacccatgctaaa
aaccaaatgaaagcctttaacgcttttttagagcagcttttaaatcaaaaaatagagttt
caataccgccatgcttacaattccgccggcatcctttctttgtgtaacgggaatgaaaat
cgcttcttaaatctctatcgcccaggcatcatgctctatggtttttacccttctaatgga
atgaaagaaacatgcccaaccattttaaaaaatgttatcagcttaaaagcccaaatcgtt
caaatcagaagcgttaaaaaaggcgaatttattggctatggcgagcatttttacaccaat
gaagaaactttagtgggtgttttagctctagggtatgcggacgggttaatgcgcgcttta
ggcaatcgcattcaagtagcgatcaataaccaattagccccccttattggcaaggtgtgc
atggatcagtgctttgttaaactcaataatatccaagccaaagagggcgatgaggtcatc
ttatttggggataaaagcgctaaggctaacgacgcaagcgaaatcgctgcacttttaaac
accattccttatgaaaccatcagcaccctatccaaacgcttggagcgcgtctatatttaa

DBGET integrated database retrieval system