KEGG   Helicobacter pylori BM012S: U064_0146Help
Entry
U064_0146         CDS       T02940                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
hez  Helicobacter pylori BM012S
Brite
KEGG Orthology (KO) [BR:hez00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hez03012]
    U064_0146
   03029 Mitochondrial biogenesis [BR:hez03029]
    U064_0146
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hez04147]
    U064_0146
Translation factors [BR:hez03012]
 Eukaryotic Type
  Elongation factors
   U064_0146
 Prokaryotic Type
   U064_0146
Mitochondrial biogenesis [BR:hez03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    U064_0146
Exosome [BR:hez04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   U064_0146
  Exosomal proteins of breast cancer cells
   U064_0146
  Exosomal proteins of colorectal cancer cells
   U064_0146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AHA89085
UniProt: V5NKF9
LinkDB All DBs
Position
138814..140013
Genome map
AA seq 399 aa AA seqDB search
MAKEKFNRTKPHVNIGTIGHVDHGKTTLSAAISAVLSLKGLAEMKDYDNIDNAPEEKERG
ITIATSHIEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPHIVVFLNKQDMVDDQELLELVEMEVRELLSAYEFPGDDTPIVAGSALRALE
EAKAGNVGEWGEKVLKLMAEVDAYIPTPERDTEKTFLMPVEDVFSIAGRGTVVTGRIERG
VVKVGDEVEIVGIRATQKTTVTGVEMFRKELEKGEAGDNVGVLLRGTKKEEVERGMVLCK
PGSITPHKKFEGEIYVLSKEEGGRHTPFFTNYRPQFYVRTTDVTGSITLPEGVEMVMPGD
NVKITVELISPVALELGTKFAIREGGRTVGAGVVSNIIE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagtttaacagaactaagccgcatgttaatattggaaccattgggcat
gtagaccatggtaaaacgactttgagtgcagcgatttcagcagtgctttctttgaaaggt
cttgcagaaatgaaagactatgataatattgataacgcccctgaagaaaaagaaagaggg
atcactatcgctacttctcacattgaatatgagactgaaaacagacactatgcgcatgtg
gattgcccaggacacgctgactatgtaaaaaacatgatcaccggtgcggcacaaatggac
ggagcgattttggttgtttctgcagctgatggtcctatgcctcaaactagggagcatatc
ttattgtctcgtcaagtaggcgtgcctcacatcgttgttttcttaaacaaacaagacatg
gtagatgaccaagaattgttagaacttgtagaaatggaagtacgcgagttgttgagcgcg
tatgaattccctggcgatgacactcctatcgtagcgggttcagctttaagagctttagaa
gaagcgaaggctggcaatgtgggtgaatggggtgaaaaagtgcttaagctcatggctgaa
gtggatgcctatatccctactccagaaagagacactgaaaaaactttcttgatgccggtt
gaagatgtgttctctattgcgggtagagggactgtggttacaggcaggattgaaagaggt
gtggtgaaagtaggcgatgaagtggaaatcgttggtatcagagctacacaaaaaacgact
gtaaccggtgtagaaatgtttagaaaagagttagaaaaaggtgaggccggcgataatgtg
ggcgtgcttttaagaggaactaaaaaagaagaagtagagcgcggtatggttctatgcaaa
ccaggttctatcactccgcacaagaaatttgagggagaaatttatgtcctttctaaagaa
gaaggcgggagacacactccattcttcaccaactatcgcccacaattctatgtgcgcacg
actgatgtgactggctctatcacccttcctgaaggcgtagaaatggttatgcctggcgat
aatgttaaaatcactgtagagttgattagccctgttgcgttagagttgggaactaaattt
gcgattcgtgaaggcggtaggaccgttggtgctggtgttgtgagtaatattattgaataa

DBGET integrated database retrieval system