KEGG   Helicobacter pylori BM012S: U064_0981Help
Entry
U064_0981         CDS       T02940                                 

Definition
(GenBank) Chorismate mutase I
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
hez  Helicobacter pylori BM012S
Pathway
hez00220  Arginine biosynthesis
hez00250  Alanine, aspartate and glutamate metabolism
hez00270  Cysteine and methionine metabolism
hez00330  Arginine and proline metabolism
hez00360  Phenylalanine metabolism
hez00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hez00401  Novobiocin biosynthesis
hez01100  Metabolic pathways
hez01110  Biosynthesis of secondary metabolites
hez01130  Biosynthesis of antibiotics
hez01210  2-Oxocarboxylic acid metabolism
hez01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hez00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    U064_0981
   00270 Cysteine and methionine metabolism
    U064_0981
   00220 Arginine biosynthesis
    U064_0981
   00330 Arginine and proline metabolism
    U064_0981
   00350 Tyrosine metabolism
    U064_0981
   00360 Phenylalanine metabolism
    U064_0981
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    U064_0981
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    U064_0981
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hez01007]
    U064_0981
Enzymes [BR:hez01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     U064_0981
Amino acid related enzymes [BR:hez01007]
 Aminotransferase (transaminase)
  Class I
   U064_0981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Alliinase_C DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AHA89896
UniProt: V5NN95
LinkDB All DBs
Position
996654..997826
Genome map
AA seq 390 aa AA seqDB search
MLYSSKIQSLSESATIAISTLAKELKSQGKDILSFSAGEPDFDTPQAIKDAAIKALNDGF
TKYTPVAGIPELLKAIAFKLKKENNLDYEPNEILVSNGAKQSLFNAIQALIEEGDEVVIP
VPFWVTYPELVKYSNGVSQFIQTDEKSRFKITPKQLKDALTPKTKMLILTTPSNPTGMLY
SKAELEALGEVLKDTPIWVLSDEIYEKLVYKGEFVSCAAVSEEMNKRTITINGLSKSVAM
TGWRMGYAASKDKKLVKLMNNLQSQCTSNINSITQMASIVALEGLVDKEIETMRQAFEKR
CDLAHAQINAIGGLNALKPDGAFYLFINIGSLCGGDSMRFCHELLEKEGVALVPGKAFGL
EGYVRLSFACSEEQIEKGMERIARFVKSKG
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgttgtattcctctaaaatccaatccctttcagaatccgcaacgatcgctatcagcaca
ctcgctaaagaattgaaatcgcaaggaaaagatattttaagtttttcagcgggcgagcct
gattttgacacccctcaagcgattaaagatgcggctataaaagccctaaatgacggcttc
accaaatacacgccagtggccgggattccggaactattaaaagcgatcgcttttaaattg
aaaaaagaaaacaacttggattatgaaccgaatgaaattctagtgagcaacggcgctaag
caaagcctattcaatgcgattcaagctttaatagaagagggcgatgaagtggttatccct
gtgcctttttgggtaacttaccctgagcttgtgaaatacagcaatggggtgagtcaattc
attcaaaccgatgaaaaaagccgctttaaaatcacccccaagcagcttaaagacgcttta
acccccaaaacaaaaatgctcattctcaccaccccatcaaaccctaccggcatgctttat
agtaaggcggagttagaggctttaggcgaagttttaaaagacactccaatttgggtgctt
agcgatgaaatttatgaaaagcttgtttataagggggaatttgtttcttgcgcggcggtg
agtgaagagatgaacaaacgcaccattaccattaacggcttgagcaagtcagtagcgatg
acaggctggcgtatgggctatgcggcgagcaaggataaaaaattagtcaaattgatgaat
aacttgcaaagccaatgcacttccaatatcaattctatcacgcaaatggcttctattgtg
gcgcttgaggggttggtggataaggaaattgaaacgatgcgtcaggcttttgagaagcgc
tgtgatttagcccacgcacaaatcaatgcgattggagggttgaatgctttaaaacctgat
ggggcgttttatctttttatcaacattggtagcctttgtgggggggattcgatgcgattt
tgccatgaattgttagaaaaagaaggcgtagcgttagtgcctggaaaggcttttggattg
gaaggttatgtccgtttgtcttttgcatgctcagaagagcagattgaaaaggggatggag
cgcatcgctcgctttgtcaaatcaaagggataa

DBGET integrated database retrieval system