KEGG   Helicobacter pylori BM012S: U064_1046Help
Entry
U064_1046         CDS       T02940                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hez  Helicobacter pylori BM012S
Pathway
hez00473  D-Alanine metabolism
hez00550  Peptidoglycan biosynthesis
hez01100  Metabolic pathways
hez01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hez00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    U064_1046
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    U064_1046
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    U064_1046
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hez01011]
    U064_1046
Enzymes [BR:hez01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     U064_1046
Peptidoglycan biosynthesis and degradation proteins [BR:hez01011]
 Precursor biosynthesis
  Amino acid ligase
   U064_1046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A ATPgrasp_TupA ATP-grasp_3 VitD-bind_III
Motif
Other DBs
NCBI-ProteinID: AHA89961
UniProt: V5NNE8
LinkDB All DBs
Structure
PDB: 

Position
1067612..1068682
Genome map
AA seq 356 aa AA seqDB search
MQSFLGSLIVEFCVLFGGASFEHEISIVSAIALKGVLKDRIKYFIFLDENHHFYLIEESN
MHSKYFAQIKEKKLPPLILTHNGLLKNSFLGAKIIELPLVINLVHGGDGEDGKLASLLEF
YRIAFIGPRIEASVLSYNKYLTKLYAKDLGVKTLDHVLVNEKNRANALNLMNFNLPFIIK
PNSAGSSLGVSVVKEEKELIYALDGAFEYSKEVLIEPFIQGVKEYNLAGCKIKKDFCFSY
IEEPNKQEFLDFKQKYLDFSRNKAPKANLSNALEEQLKENFKKLYNDLFSGAIIRCDFFV
IENEVYLNEINPIPGSLAHYLFDDFKTTLENLAQSLPKIPKIQIKNSYLLQIQKNK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatcgtttttagggagtttgatcgtggagttttgcgttttatttggtggggcgagt
tttgagcatgaaatcagcattgtgagcgcgatcgcgcttaaaggagtgttaaaagatagg
attaaatattttatttttttagatgaaaaccaccatttttatttgattgaagaatccaac
atgcattcaaaatacttcgctcaaatcaaagaaaaaaaattaccccccctaattctcaca
cacaatggcttgctcaaaaactcgtttttaggcgctaagattatagaactgcctttagtg
atcaatctcgtgcatgggggcgatggcgaagacgggaaattagcgagcttgttagaattt
tatcgtatcgcttttataggccctaggattgaagcgagcgtgttgagttataacaaatat
ttaaccaagctttacgccaaagatttaggggtaaagactttagatcatgttcttgtgaat
gaaaaaaaccgcgctaacgccctaaatttgatgaactttaatcttcctttcataatcaaa
cctaatagcgctgggagctctttaggggtgagcgttgtgaaagaagaaaaagaattgatt
tacgctttagacggcgcgtttgaatattctaaagaagtcttaatagagcctttcattcag
ggagtgaaagaatacaatttagccggttgcaagatcaaaaaggatttttgtttttcctat
attgaagagcctaacaaacaagaatttttagatttcaaacaaaaatatttggatttttca
cgcaataaagcccctaaagcgaatctttctaacgccctagaagagcaattgaaagaaaat
tttaaaaaactctataacgatttatttagtggcgcgatcattcgttgcgatttttttgtc
atagaaaatgaagtgtatcttaatgagatcaaccccattcctggcagtttggcccattat
ttgtttgatgattttaaaacaacgctagaaaatttagcgcaatcattgcccaaaatcccc
aaaatccaaatcaaaaactcttatttgttgcaaatccaaaagaataagtaa

DBGET integrated database retrieval system