KEGG   Helicobacter felis: HFELIS_06990Help
Entry
HFELIS_06990      CDS       T01375                                 

Definition
(GenBank) hydroxymyristoyl-(acyl-carrier protein)dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
hfe  Helicobacter felis
Pathway
hfe00061  Fatty acid biosynthesis
hfe00780  Biotin metabolism
hfe01100  Metabolic pathways
hfe01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:hfe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HFELIS_06990
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HFELIS_06990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hfe01004]
    HFELIS_06990
Enzymes [BR:hfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     HFELIS_06990
Lipid biosynthesis proteins [BR:hfe01004]
 Fatty acid synthase
  Component type
   HFELIS_06990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: CBY82783
UniProt: E7AB23
LinkDB All DBs
Position
680959..681456
Genome map
AA seq 165 aa AA seqDB search
MQNCVLEMDIHAIAQILPHRYPFLLVDRVVRLETYKQVHAYKNITYNEEVFTGHFPSKPI
YPGVLIVEGMAQAGGLLAFVSLFGVSPEIAQTKLVYFMTIDSVKFRNPVIPGDQLHYHLE
VLKYKGMIWQVGGTARVNDKIMAEAELKAMIVDKESGKRNSGEQA
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaattgtgtgctagagatggacatccatgccatcgctcagattctccctcaccgc
tacccttttttgcttgtggatcgagtggtgcgcctagaaacttataaacaagtgcatgca
tataaaaatattacctataatgaagaggttttcactgggcacttccccagcaaacccatt
taccccggggtgctcattgtagagggcatggcgcaggcgggcgggcttttagcctttgtg
agcttgtttggagtgagtccagagattgcacaaactaaattggtctactttatgactatc
gactctgtcaagtttcgcaatccagtaatcccgggcgatcagctccactatcatttggag
gtgctcaaatataagggtatgatttggcaagtagggggcacagctagggttaatgataaa
atcatggcagaagcggagttaaaggccatgatcgtggataaagagagcggtaaaaggaac
tcaggagagcaagcatga

DBGET integrated database retrieval system