KEGG   Helicobacter felis: HFELIS_16480Help
Entry
HFELIS_16480      CDS       T01375                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
hfe  Helicobacter felis
Pathway
hfe00250  Alanine, aspartate and glutamate metabolism
hfe00410  beta-Alanine metabolism
hfe00430  Taurine and hypotaurine metabolism
hfe00650  Butanoate metabolism
hfe01100  Metabolic pathways
hfe01110  Biosynthesis of secondary metabolites
hfe01120  Microbial metabolism in diverse environments
hfe02024  Quorum sensing
Module
hfe_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:hfe00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    HFELIS_16480
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HFELIS_16480
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HFELIS_16480
   00430 Taurine and hypotaurine metabolism
    HFELIS_16480
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    HFELIS_16480
Enzymes [BR:hfe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     HFELIS_16480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CBY83732
UniProt: E7ABM7
LinkDB All DBs
Position
complement(1586997..1588445)
Genome map
AA seq 482 aa AA seqDB search
MLHTKSHIQRDNEKFVFKADNSSTPIFGSAESDVLLPRDKIGKNMMDPRIAYQLVSDEMM
HDGNPRYNLCTFVQTYMEEEARKIMLDSMATNAIDKSEYPQTTEIEKRCVNIIANLWNAN
HAEDFMGTSTVGSSEACMLGGMAMKFRWRKRAQALGIDISKQKPNLIVSSGYQVVWEKFC
VYWDVELREVPMSDFNNLTLDPKEAIKLCDDYTIGIVPIMGITYTGGFDDIVTLDRLLSE
YNQKAKISVSIHVDAASGGLYLPFINPDLTWDFRLKNVVSISTSGHKYGLIYPGIGWVMW
RDKQFLPDELIFKVAYLGDFEPTFQINFSRSGSQIWAQYYCFVRWGFEGYKAVHAKTRDV
GLFLARGIKSLGLFDMINEGQNIPIICWTMNTKAQKEKQWNLYDLADRLRFNGWQVPAYP
LPANFQNVSVMRIVVRADQSMEQMSLFLKDLKQAIRELDTANLVSHKHPSESDDVVPVGY
TH
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgttgcatacaaagagtcatattcaaagagataatgaaaagtttgtcttcaaggcagac
aattcctctacacctatttttggtagcgctgagagcgatgtcctattgccccgcgataag
attggtaaaaatatgatggatccgcgcatcgcctatcaattagtttctgatgagatgatg
cacgatggtaacccgcgctacaatctttgcacctttgtgcaaacctacatggaagaggaa
gctagaaaaatcatgctcgattctatggcgactaatgccattgataaatccgagtatcct
caaactacagagattgaaaaacgctgtgtgaatatcattgccaatctttggaatgctaac
catgcagaggattttatggggacttccactgtgggctcttcagaagcgtgtatgttgggc
gggatggcgatgaaatttcgttggagaaaacgcgcgcaggctctaggaattgacatcagc
aaacaaaaacctaatctcattgtcagctctggctatcaagtagtttgggaaaaattctgt
gtctattgggatgttgaattgcgcgaagtgcctatgagtgattttaacaacctcacctta
gaccctaaagaagcgattaaactctgcgatgattacaccataggcattgtgcccattatg
gggatcacttacacgggcggatttgacgacatcgtaactttagacagacttcttagtgaa
tacaaccaaaaagctaaaatcagcgtgtccatccatgtcgatgccgcttcgggtgggttg
tatctcccctttatcaatccggatttaacttgggattttcgcttaaaaaatgtcgtttcg
atctccacctctgggcataaatatgggctcatttatccgggaattggctgggtgatgtgg
cgggataaacaatttttacccgatgagctgatctttaaagtggcgtatttgggagatttt
gagcctacttttcaaatcaatttctctcgctcaggttcgcagatttgggcacaatactat
tgctttgtgcgctggggctttgaggggtataaagctgtgcatgcaaaaacccgcgatgtg
ggactcttcttagcaaggggcattaaatccttagggctttttgacatgattaatgagggg
cagaatattcccatcatctgctggaccatgaacactaaagcgcaaaaggaaaagcaatgg
aatctttacgatttagccgatcgtctgcgctttaatggttggcaggtccctgcttatcct
cttcctgccaatttccaaaatgtctctgtgatgcgcattgtggttcgagccgatcagagc
atggagcaaatgtcgctctttttaaaagatttgaaacaagccatcagagagctagataca
gcaaacctagtgagccataagcacccatcagaaagtgatgatgtcgtcccggtaggctat
acgcattaa

DBGET integrated database retrieval system