KEGG   Haloferax gibbonsii: ABY42_07475Help
Entry
ABY42_07475       CDS       T04025                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hgi  Haloferax gibbonsii
Pathway
hgi00564  Glycerophospholipid metabolism
hgi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hgi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ABY42_07475
Enzymes [BR:hgi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ABY42_07475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 Pyr_redox_2 FAD_binding_3 Fer2_BFD NAD_binding_8 FAD_oxidored DAO_C 3HCDH_N Pyr_redox Pyr_redox_3 HI0933_like YbjQ_1 ApbA Lycopene_cycl Thi4 GMC_oxred_N GIDA
Motif
Other DBs
NCBI-ProteinID: AKU07590
UniProt: A0A0K1ITD7
LinkDB All DBs
Position
1416376..1418160
Genome map
AA seq 594 aa AA seqDB search
MKKSPSVLVIGGGSTGTGIARDLAMRGLDVTLVEKGNLTHGTTGRMHGLLHSGGRYAVSD
QPSAKECIEENRVLRRIAGHCVEMTGGLFVQRPEDSDEYFEKKLEGCRECGIPAEVLSAE
EAREIEPYLAKDIKRAIKVPDGAVDPFRLCVANAASAVEHGARIETHSEVTDVLVEDGEV
VGVEVTHQTGTGPYVHGEPGEVEEIRADYVVNATGAWAGQIGDLAGVDVEVRPSKGVMTI
MNTRQVDTVVNRCRPKGDADIIVPHETTCILGTTDEEVEDPEDYPEEGWEVDLMIETLSE
LVPMLAEARTIRSFWGVRPLYEPPGTGTEDPTDITREFFLLDHDDRDDLPGMTSIVGGKL
TTYRMMAEQISDHVCEKLDVEAECRTADVPLPGSEDFTVLRDYMDDFGLRSPIGRRSAQR
LGSRADEVLNSVDPNPVVCECEAVTRAEIQDSLDTAGTELNSVRIQTRASMGNCQGAICC
HRMANELAPEYDEETIRASLDDLYQERWKGERHAMWGTQLSQTALKHMLHAATMNRDEDP
AAADADIDFAAFDDGGASEGDASGVASGGAVADGGRERTDRADDDALGGADGDN
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatcgccgagcgtcctcgtcattggcggggggtcgaccggcacgggcatcgcg
cgcgacctcgcgatgcgcgggctggacgtgaccctcgtcgagaaggggaatctcacacac
gggacgacggggcggatgcacggactcctccacagcgggggccggtacgcggtgtcggac
cagccgtccgccaaggagtgtatcgaggaaaaccgggtcctgcggcgaatcgccggccac
tgcgtcgagatgacgggagggctgttcgtccagcgccccgaggactccgacgagtacttc
gagaagaagttagagggctgtcgcgagtgcggcatccccgccgaggtgctgtcagccgag
gaggcgcgagagatagaaccgtacctcgcgaaggacatcaagcgcgccatcaaggtgccg
gacggcgcggtcgacccgttccgcctctgcgtggcgaacgccgcgagcgccgtcgaacac
ggcgcgcgcatcgagacgcactcggaggtcacggacgtgctcgtcgaggacggcgaggtc
gtcggcgtcgaggtcacccaccagaccggcaccgggccctacgtccacggcgaacccgga
gaagtcgaggaaatccgcgccgactacgtcgtcaacgcgacgggcgcgtgggccggccaa
atcggtgacctcgccggcgtcgacgtggaagtccgcccgtcgaagggcgtcatgaccatc
atgaacacccggcaggtcgacacggtcgtcaaccgctgtcggccgaagggcgacgccgac
atcatcgtcccgcacgagacgacgtgcatcctcgggacgaccgacgaggaggtcgaggac
ccggaggactaccccgaggagggctgggaggtcgacctgatgatagagacgctgtcggag
ctcgtgcccatgctggccgaggcgcggacgattcgctccttctggggcgtccgtccgctg
tacgaaccgccgggcaccggcacggaggacccgacggacatcacccgcgagttcttcctg
ctcgaccacgacgaccgcgacgacctgccgggcatgacgagcatcgtcggcggcaaactc
acgacctaccggatgatggccgagcagatttcggaccacgtctgcgagaagctcgacgtg
gaggccgagtgccgcaccgccgacgtgccgctgccgggcagcgaggacttcaccgtcctc
cgcgactacatggacgacttcggcctgcggtcgcccatcggccgccggtcggcccagcga
ctcggctcgcgcgccgacgaggtgctcaacagcgtcgaccccaacccggtcgtctgcgag
tgcgaggccgtcacccgcgccgagattcaggactctctcgacaccgcgggtacggaactc
aactccgtgcgcatccagacgcgcgcctcgatgggcaactgtcagggcgcgatttgctgt
caccggatggcgaacgaactcgcccccgagtacgacgaggagaccattcgcgcgtccctc
gacgacctctaccaggagcgctggaagggcgagcgccacgccatgtggggcacgcagctc
tcacagaccgcgctgaagcacatgctccacgcggcgacgatgaaccgcgacgaggacccc
gcggcggccgacgccgacatcgacttcgccgcctttgacgacggcggtgcctcggagggc
gacgcctcgggcgtcgcgtccggcggggcggtcgcggacggcggccgcgagcgaaccgac
cgcgcggacgacgacgcgctcggaggtgccgatggcgataactga

DBGET integrated database retrieval system