KEGG   Heterocephalus glaber (naked mole rat): 101696496
Entry
101696496         CDS       T02812                                 

Gene name
Osmr
Definition
(RefSeq) oncostatin M receptor
  KO
K05057  oncostatin M receptor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04151  PI3K-Akt signaling pathway
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101696496 (Osmr)
   04151 PI3K-Akt signaling pathway
    101696496 (Osmr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101696496 (Osmr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101696496 (Osmr)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL6/12 receptor family
   101696496 (Osmr)
SSDB
Motif
Pfam: fn3 LIFR_D2 EpoR_lig-bind IL6Ra-bind
Other DBs
NCBI-GeneID: 101696496
NCBI-ProteinID: XP_004848645
LinkDB
Position
Un
AA seq 986 aa
MGRPAAPARNPEPMAFFAVFRTAFLLAVLSWRTCQSEVLPERLPLTPESLHISINSTLQH
LHLQWTVHKLPYQELQMIFQIEISRFETSKVIWMGNYSTTVKRNQVLQWSWESELPLECA
THFVRMKSTVDDARFPELSFSSNWSPWEEVHAHTPEQNTDLIFPRDKLVEEGSNVTFCYN
SGINQNISCYLDRELIHGEQLYLNIFTFKLNNVPFIREGGTNIYCAVNYTIKDGTVLFVS
KVLEEPKDFSCETQDFKTLSCSWDPGVDTGLFFDGQPSQHYTLFESFSGKKKFCEHNNQC
NWEISRDLQETYNFTLTAENYLRKRSVNTIFNLTHRVHPKAPDSIHFNNVGATNATMTWK
MPALGNYSTLLCQIELHDKENMRQEHNVSIKVNGEFLFSELMPDTAYMVCIRCANAKHVW
KWSKWVTRTLITAEAAPSKALDVWRKVKPEKGLHHVTLFWKPLSKFHANGKILFYNIVAK
DLDKKSELKLQSIPAPANGTELTLDQGSYQIQVTANNSVGASPASEIVISGDSGNEEVEE
QKINGTKDGFLISWKPLSEDRAGYVVDWCEHQRNLHCELQWKNVGPNTTSTVISSDAFRP
GIRYNFRIYELSTEKIAYLVENKIGYTQELAPSDSPQVKAINVTSHSFTLSWKDYDTEAQ
RGFIQGYRVCLKSKATQCHLDSVAELLPDNSTCCEHAINNPKQKIFLVENLQPESFYEFF
VSSFTSAGKSPIGTFTKVTTQDEHSHMLMHIILPMVLCVLLIAVMCYWKSQWVKEKCYPD
IPDPYKSSILSLIKSKESPHLRIMNVKDCTPDTIEVVNKSEGTKTQFIGIEKPLTESEFP
KPANLYLLPAQDFCVPGPCISFVNHTYSESACDSGSCAHTPVPDTAPPCHLELLASPDNL
LNTLEKTHTDSLGEIPAGKISLNYVSQLASPMSGDKDSLLIHSPVPVLCSEYKMQMAVPS
CLDSPVLSENGSLSSMTLLGQDKHYH
NT seq 2961 nt   +upstreamnt  +downstreamnt
atgggccggcccgcggcgcccgcgcgaaatccagaacccatggctttctttgcagtcttt
cgaacagcattcctgttagcagtgctgtcttggagaacttgccagagtgaagtcttgcct
gagcgtttaccattgactcctgaatcacttcacatttccatcaattctacacttcagcat
ttgcatttacaatggactgtccacaagcttccttaccaggaattacaaatgatatttcaa
atagagatcagtagatttgaaacatccaaagtcatctggatgggtaattacagcaccact
gtgaagaggaaccaagttttgcaatggtcctgggaatccgagctccctttggaatgtgca
acacactttgtaagaatgaagagtacagtggatgatgccaggttccctgagctgagtttc
tcaagcaactggagcccatgggaggaagttcatgcccacactcctgaacagaatactgac
ttgatattccctagagataagctggtggaagaaggctccaatgtcacgttttgttacaat
tctggaataaatcaaaacatatcctgctatttggatcgtgaactgattcatggagaacaa
ctttatttgaatatattcacattcaagttgaataatgttcctttcattagggaaggaggg
acaaatatctactgtgcagtgaattatacaattaaggatggcactgttctctttgtgtca
aaagtgcttgaggagcccaaggacttttcttgtgaaactcaggacttcaagactctaagc
tgctcctgggatcctggggtggacactggcttgttttttgatggacagccttcgcaacac
tacactttatttgaatcattttctgggaaaaagaaattttgtgaacacaacaaccagtgc
aattgggaaatctctcgagatttgcaagaaacatacaacttcacactcacagctgaaaat
tacttgaggaagaggagtgtcaatacaatttttaacctgacgcatcgagttcacccaaag
gctcccgacagtatccattttaataatgtaggtgccacaaatgccacaatgacttggaag
atgcctgcccttgggaattattccacacttctgtgtcagattgaactccatgataaagaa
aatatgagacaggaacataatgtctccatcaaggtgaatggtgagtttctcttcagtgag
ctgatgcctgacacagcgtatatggtctgcatacgctgtgccaatgccaaacacgtgtgg
aagtggagcaagtgggtcactcggaccctcatcacagctgaagctgctccctccaaggct
cttgatgtctggagaaaagtgaagccagagaaaggacttcatcatgtgaccttattttgg
aagccactatcaaaatttcatgccaatggcaagatcctattctataatatagtcgcaaaa
gatctagataaaaaatctgagttaaagctccagtctattcctgcaccggccaatggcaca
gaactaactctcgaccagggttcttaccaaatccaagtcacagctaacaacagtgtgggt
gcttcccctgcctcagagattgtcatatctggagactctgggaatgaagaggttgaagaa
caaaaaattaatggcaccaaagatggattccttatttcttggaaacccctatctgaagac
agggcaggatatgttgtggactggtgtgagcatcaaaggaacctgcactgtgaattacag
tggaagaatgtaggtcccaataccacaagtacagtcatcagctcagatgcttttagaccg
gggatccgatacaacttcagaatttatgaactatctacagaaaagattgcttatttagta
gagaacaaaataggatatacccaggaactggctccttctgacagccctcaagtgaaagcc
attaatgtgacatcccactccttcactctgagctggaaggattacgacactgaggcccag
cgtggtttcatacaaggataccgggtctgtctgaagtccaaggccactcagtgccatcta
gattctgtagcggagcttctgccagataattcaacatgttgtgaacatgccatcaacaac
ccaaaacagaagatattccttgtggaaaatctgcaacctgaatctttctacgagtttttc
gtctcttccttcacaagtgctggcaagagccccattggaactttcacaaaggtcacaacc
caagatgaacactcccacatgctgatgcatatcatactgcctatggtactctgtgttttg
ctcattgcagtcatgtgctactggaagagccagtgggtgaaggagaagtgttatcctgac
attccagatccttacaagagcagcatcctgtcattaataaagtccaaggagagccctcac
ttaagaataatgaatgtcaaagactgcactccagacactattgaagttgtaaacaaatca
gaaggaaccaaaacacagttcataggcattgagaagccactcacagaaagtgaattcccc
aagcctgccaacctttacctcctgccagcccaggatttctgtgtccctggcccctgcatc
tcttttgtgaaccacacctatagtgagtcagcttgtgactctggttcctgtgcccatacc
ccagtacctgatacagccccaccatgtcacctggagctattggcctcacctgacaattta
ctaaacactctagaaaaaacacacacagattccctgggggaaataccagctggaaaaatt
agtttgaattatgtgtcccagttggcttcccccatgtctggagacaaggacagtcttcta
atacattcaccagtgccagtactctgttcagagtataaaatgcaaatggcagtaccctca
tgccttgactcacctgtccttagtgaaaatggcagcctctcttcaatgactcttttaggt
caagataaacactaccattaa

KEGG   Heterocephalus glaber (naked mole rat): 101696651
Entry
101696651         CDS       T02812                                 

Gene name
Il2ra
Definition
(RefSeq) interleukin 2 receptor subunit alpha
  KO
K05068  interleukin 2 receptor alpha
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04061  Viral protein interaction with cytokine and cytokine receptor
hgl04144  Endocytosis
hgl04151  PI3K-Akt signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04640  Hematopoietic cell lineage
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl05162  Measles
hgl05166  Human T-cell leukemia virus 1 infection
hgl05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101696651 (Il2ra)
   04151 PI3K-Akt signaling pathway
    101696651 (Il2ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101696651 (Il2ra)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101696651 (Il2ra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101696651 (Il2ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101696651 (Il2ra)
   04658 Th1 and Th2 cell differentiation
    101696651 (Il2ra)
   04659 Th17 cell differentiation
    101696651 (Il2ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101696651 (Il2ra)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101696651 (Il2ra)
   05162 Measles
    101696651 (Il2ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101696651 (Il2ra)
   04090 CD molecules [BR:hgl04090]
    101696651 (Il2ra)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL2 receptor family
   101696651 (Il2ra)
CD molecules [BR:hgl04090]
 Proteins
  101696651 (Il2ra)
SSDB
Motif
Pfam: Sushi GAPT
Other DBs
NCBI-GeneID: 101696651
NCBI-ProteinID: XP_004854755
LinkDB
Position
Un
AA seq 269 aa
MEPRLLTWGLFTFIMVPGCMTEDCDQHPPIISYATFKAHTYKKGTLIDCECKKGFRRIRN
GSIYLLCIGNSSWANKCQCVSASSRNTSEQVTPQPEEHKEKSSTEMQSQVQPVEKVNLPG
ECWEPPAWKHEAANRTYHFKVGQIVRYECIQGYKAIQTSPVISVCKMTCGKTKWTWPQIT
CINESKLHLFAGQEDSPASTDALPESKASCPTTSTEFSKERETATTMETPIFPSEYHVAV
AGCVFLLISILLLSGLTWQWRWKKSRRAI
NT seq 810 nt   +upstreamnt  +downstreamnt
atggagccacgcttgctgacatggggattattcacattcatcatggtacctggctgtatg
acagaggactgtgaccagcacccaccaatcatcagctacgccacattcaaagcccacacc
tacaagaaaggcaccttgatagactgtgaatgcaagaaaggtttccgcaggattcgaaat
gggtcaatctatctgctttgtataggaaactcttcctgggccaacaaatgtcaatgtgta
agcgcttcctctaggaatacatcagaacaagttacacctcaacctgaagaacacaaagaa
aaaagctccacagaaatgcaaagtcaggtgcagcctgtggaaaaagtaaatcttccaggt
gaatgctgggagccccctgcatggaaacatgaagctgcaaatagaacttaccatttcaag
gtggggcagatagttcgctacgaatgcatacaggggtacaaggccatacagacaagtccc
gtcataagtgtctgcaaaatgacctgtgggaagacaaagtggacctggccccagatcaca
tgcataaatgaaagcaagctccatttgtttgcaggtcaggaagactctcctgcaagcaca
gacgcccttcctgaaagcaaggcttcctgtcccaccacatcaacagagttttcaaaagag
agagaaacagctacaaccatggagactcccatatttccaagcgagtatcatgtagcagtg
gctggctgtgttttcctgctgatcagcatcctccttctgagtggcctcacctggcagtgg
agatggaagaagagtagaagagccatctag

KEGG   Heterocephalus glaber (naked mole rat): 101696721
Entry
101696721         CDS       T02812                                 

Gene name
Il3ra
Definition
(RefSeq) interleukin 3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04151  PI3K-Akt signaling pathway
hgl04210  Apoptosis
hgl04630  JAK-STAT signaling pathway
hgl04640  Hematopoietic cell lineage
hgl05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101696721 (Il3ra)
   04151 PI3K-Akt signaling pathway
    101696721 (Il3ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101696721 (Il3ra)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101696721 (Il3ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101696721 (Il3ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101696721 (Il3ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101696721 (Il3ra)
   04090 CD molecules [BR:hgl04090]
    101696721 (Il3ra)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL3 receptor family
   101696721 (Il3ra)
CD molecules [BR:hgl04090]
 Proteins
  101696721 (Il3ra)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind fn3 EpoR_lig-bind
Other DBs
NCBI-GeneID: 101696721
NCBI-ProteinID: XP_012921919
LinkDB
Position
Un
AA seq 434 aa
MSRGSGDVVKRISRHRPPASAQAGVRVFAALPGRSPAAPAAALSSRHCPGRQEEALPGQR
GAASSPLAPALAPGPGGSGGLRETREVAGFVLQVHASRVWSDSTMPGPWLSPPLLLLLLP
PACCPRPAAPELGVPIGNLRVEPGSRRLTWDLLGNASGIECFKDGSTCLMAYDKYCHYST
MSLCTVTNYTVKVTQPAFSAWILFPESGSNAEAAARDLKCKIFDGGPMVCSWAVGTGAPG
DVQYQLSWRNLESEEEGVCLRYNTDAQGRNIRCQFDQVRALPEFMMITVNGRSNGFRVPC
TDLSIELAAIAETLLPPNISTECNRTHVHLSWLPPRSHFRNNFKYELQTEQIPGGSPVPV
NSLSTNEFLLPNPGRCTVRIRARYRSNRWTAWSPPQAFGCDREESSQQQRLWPASVLAAL
GTLLLAAAALLLCR
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgtcccggggctcgggggatgtggtgaagcggatatcgcggcaccggccgccggcgtcg
gcccaggctggagtcagggtgttcgcagccctgccgggccggtccccagctgcacctgca
gctgcactgagttcccggcactgcccgggccggcaggaagaggctctgccagggcagcgg
ggggcggcttcctccccgctggctccagcgctggcgccaggccccggagggagcggcggc
ctcagggagacccgggaggtcgcgggctttgtcctgcaggtgcacgcgtcccgtgtctgg
agcgacagcaccatgccaggcccgtggctctcgccgccgctgctgctgctgctgctgccg
cccgcctgctgcccgcgtccggccgccccggagcttggtgtgcccatcgggaacctccgg
gtagagccgggcagcaggaggctgacctgggacctgctcgggaatgcgtcgggcatcgag
tgcttcaaagacggcagcacctgcctcatggcatatgacaagtactgccactacagcacg
atgtccttgtgcactgtgacaaactacacggtcaaggtgacccagccggcgttctcagct
tggatcctctttcctgagtcaggtagcaatgcagaggcagcagccagggacttgaagtgc
aagattttcgacgggggccccatggtctgcagctgggcagtgggcaccggggccccggga
gacgtgcagtaccagctgtcctggaggaaccttgaatcagaggaggagggcgtgtgtctc
cgttacaacacggacgcccagggcaggaacatcagatgccagttcgatcaagtccgtgcg
cttcccgaattcatgatgatcacagtgaacgggaggagcaatggcttccgtgtgccctgc
acagacttaagcatcgagttggcagccattgcagagactctcctgccccccaacatcagc
accgagtgcaaccgcacccacgtgcacctgtcctggctgccgccgcggagccacttccgg
aacaatttcaagtacgagctccagaccgaacagatcccgggcggctctccggtccctgtc
aacagcctcagcacgaacgagttcctcctgcccaaccctgggcggtgcaccgtgcggatt
cgagcgcgctatcggtccaacaggtggacggcgtggagcccgccccaggccttcggctgt
gaccgggaggagagctcgcagcagcagcggctgtggcccgcgtccgtgctggcggcgctg
gggacgctgctcctggcggcggcggccttgctcctctgcaggtga

KEGG   Heterocephalus glaber (naked mole rat): 101696861
Entry
101696861         CDS       T02812                                 

Gene name
Lifr
Definition
(RefSeq) leukemia inhibitory factor receptor alpha
  KO
K05058  leukemia inhibitory factor receptor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101696861 (Lifr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101696861 (Lifr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101696861 (Lifr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101696861 (Lifr)
   04090 CD molecules [BR:hgl04090]
    101696861 (Lifr)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL6/12 receptor family
   101696861 (Lifr)
CD molecules [BR:hgl04090]
 Proteins
  101696861 (Lifr)
SSDB
Motif
Pfam: LIFR_D2 LIFR_N fn3 IL6Ra-bind Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 101696861
NCBI-ProteinID: XP_004848646
UniProt: G5ANE3
LinkDB
Position
Un
AA seq 1095 aa
MDISLCWRQPSGMVGSKRMRMPANFRWLVATFVLLYLLNQVNSQKKGTRDLKCTTNNLQV
WDCSWKAPLGTGRGTIYKVCIEDRPRSCHQLEKTNIKIPALSPGDHEITINSLHDSESSI
STFMLNEKNVSLIPDTPEILNLSADFSTSTLYLKWNDKGSVFPHHSNIIWEVKVLRKDSM
ELVELVTYNTTLNGRDIVHHWSWASDMPLECATHHVRIRCYIDSLHFSGLKEWSDWSPVK
NISWTSDSQTKVFPQDNIILVGSDITFCCISQEKVLLAQIGSKNCPLIHLDGENVAIKIH
NISVSENSGTNVIFTTEDYIYGTVIFAGYPPDVPQKLNCETHDLEEIVCTWNPGRPTALV
GPRSTNYNLFESFSGKYVRFKNAEVPTNESYRVLFKMIPNQEIYNFTLSGHNPLGQSEST
ILINITERVSPHTPTSFRVKDINSNAVTLSWHLSGSFAKINLLCQIKINKANSGQELRNI
TIKGVENSSYRVAVDKLNPYTMYTFRIRCSSETYWKWSKWSNEKQHLTTEATPSKGPDTW
REWSSDGKNLIIYWKPLPINDANGKILSYNVSCSSVEETQSLSEIPDPQHKAEIRLDKND
YIISVVAKNSVGSSPPSKIASMEIPNDDLRVEQVVGMGKRILLTWHPDPNMTCDYVIKWC
NSSQFEPCLMDWKKVPSNSTEAIIESDQFRPGIRYNFFLYGCRNQGYQLLRSIIGYIEEL
APIVAPNFTVEDTTADSILVKWEDIPVEELRGFLRGYLFYFEKGEKDASQMRGLESGHSD
IKVKNITDISQKTLRIADLQGKTSYHLVLRAYTDGGLGPEKSMFVVTNENSVGLIIAILI
PVAVAVLIGVVTSLLCYRKREWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLEMNP
CTPNNVEVLETRSTLPKIEDTEIISPVAERPVDSSDVEPENHVVVSYCPPIIEEEIPNPA
VDEPGGTSQVIYIDVQSMYQPQAKPEEDQEMDPIVSAGYKPQMRLPINSTVEESAAEDDI
DKTAGYRPQANVNTWKLVSPDSPRSTDSNSEIVSFGSPCSINSRQFLIPPKDEDSAKSSG
GGWSFSNFFQNKPND
NT seq 3288 nt   +upstreamnt  +downstreamnt
atggacatttccttatgttggagacagccatccgggatggtgggcagtaagagaatgagg
atgcctgcaaatttccggtggctcgtagcaacatttgttcttctgtatctactgaatcaa
gtaaacagccagaaaaaggggacacgtgatttgaagtgcacaactaacaatttacaagta
tgggactgttcttggaaagcacccctaggaacaggtcgtggtaccatttataaagtttgc
attgaagacaggccccgttcttgtcatcaattagagaaaacaaatattaagatcccagct
ctttcacctggtgatcatgaaataacaataaactctctacatgattctgaaagttctata
agtacattcatgctaaatgaaaaaaatgtttccttaattccagacactccagagatcttg
aatttgtctgctgatttctcaacctctacattatacctaaagtggaatgacaaaggttct
gtttttcctcatcactcaaatatcatctgggaagtcaaagttctacgtaaagatagcatg
gagctcgtagaattagtgacttacaacacaactctgaatggcagagatatagttcatcac
tggagttgggcctcagacatgcccttggagtgtgccactcatcatgtgagaattaggtgc
tacattgactctcttcatttctctggtctcaaagagtggagtgactggagcccagtgaaa
aacatttcttggacttctgattctcagaccaaggtttttcctcaagacaacataatactt
gtaggctcagacataacattttgttgtataagtcaagaaaaagtgttattggcacagatt
ggcagtaaaaattgtccccttatccatctcgatggagaaaatgttgccatcaagatccat
aatatatctgtttctgaaaatagtggaacaaatgtgattttcacaacagaagattacata
tatggaacagttatttttgcaggatatccacctgatgttcctcaaaaactgaattgtgaa
acacatgatttagaagaaattgtgtgtacttggaatccaggaagaccaacagcattggtg
ggcccacgaagtacaaattacaatttatttgaaagtttttcaggaaaatatgttagattt
aaaaatgctgaagtacctacaaatgaaagctatcgggtactctttaaaatgattccaaat
caagaaatatataattttactctgagtggtcacaatcctcttgggcaatcagaatcaaca
atactcattaacatcactgaacgagtttctccacatactcctacttcattcagagtgaag
gatattaattcaaatgctgttacactttcttggcatttatcaggcagctttgcaaagata
aatcttttatgtcaaattaaaattaataaagctaattcaggacaagaattgcggaatatc
acaatcaaaggagtggaaaattcaagttatcgtgttgctgtggacaaattaaatccatat
actatgtatacttttcggattcgttgttcttctgaaacttactggaaatggagcaaatgg
agcaatgaaaaacaacatttaaccacagaagccactccttcaaagggaccagatacttgg
agagagtggagttctgatgggaaaaatttgataatatactggaagcctttacctattaat
gatgctaatgggaaaatcctttcctataatgtatcatgttcatcagttgaggaaacacaa
tccctttctgagatccccgatcctcaacacaaagcagaaatacgcctggataaaaatgat
tatatcatcagtgtggtagcaaagaactctgttggctcatcaccaccttctaaaatagcc
agtatggaaatcccaaatgatgatctcagagtagagcaggttgttggaatgggaaagagg
attctcctcacctggcatcctgaccccaacatgacttgtgactatgttattaagtggtgt
aattcatctcagtttgagccctgccttatggattggaaaaaagttccttcaaacagcact
gaggccataatagaatctgatcagtttcgaccaggtatcagatataattttttcctgtat
gggtgcagaaatcaaggatatcaattattacgttccataattggatatattgaagaattg
gctccaattgttgcaccaaattttactgttgaagatacaactgcagattccatattagta
aaatgggaagatattcctgtggaagagcttagaggctttttaagagggtatttattttac
tttgaaaaaggagaaaaagatgcatctcaaatgagaggtttggagtcaggtcattctgac
atcaaggtgaagaatattactgacatatctcagaagacactaagaattgctgatcttcaa
ggtaaaacgagttaccatctggttctgcgagcctacacagatggtggcctgggcccagag
aagagcatgtttgtggtgacaaacgaaaactctgtgggattaattattgccattctcatc
ccggtggcagtggctgtccttattggagtggtaacaagtcttctttgctatcggaaacga
gagtggattaaggagaccttctaccctgatattccaaatcctgaaaattgtaaagcatta
cagtttcaaaagagtgtctgcgaggggagcagtgctcttaaaacattggaaatgaatcct
tgtaccccaaataatgttgaggttctggaaactcggtcaacacttcctaaaatagaagac
acagaaataatttccccagtagccgagcgtcctgtagatagttctgatgtagagcctgaa
aaccatgtggttgtgtcctattgcccaccgatcatcgaggaagaaattccgaacccagct
gtggatgaaccaggaggtacttcacaggtcatctacattgatgttcagtccatgtatcag
cctcaggccaagccagaggaagaccaagaaatggatcccatagtttcagcaggctataag
ccacaaatgcgtctccctattaactctactgtagaagagtcagctgcagaggatgacata
gataaaactgcaggttaccgacctcaggcaaatgtaaatacttggaaattggtctctcca
gactctcctagatccacagatagcaacagtgagattgtctcttttggaagtccatgctcc
atcaattcccgacagtttttgattccccctaaagatgaagactctgctaaatcaagtgga
ggagggtggtccttttcgaacttttttcagaacaaacctaatgattaa

KEGG   Heterocephalus glaber (naked mole rat): 101697360
Entry
101697360         CDS       T02812                                 

Gene name
Pdgfra
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl04010  MAPK signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04020  Calcium signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04144  Endocytosis
hgl04151  PI3K-Akt signaling pathway
hgl04510  Focal adhesion
hgl04540  Gap junction
hgl04630  JAK-STAT signaling pathway
hgl04810  Regulation of actin cytoskeleton
hgl05163  Human cytomegalovirus infection
hgl05200  Pathways in cancer
hgl05206  MicroRNAs in cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05230  Central carbon metabolism in cancer
hgl05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101697360 (Pdgfra)
   04014 Ras signaling pathway
    101697360 (Pdgfra)
   04015 Rap1 signaling pathway
    101697360 (Pdgfra)
   04630 JAK-STAT signaling pathway
    101697360 (Pdgfra)
   04020 Calcium signaling pathway
    101697360 (Pdgfra)
   04072 Phospholipase D signaling pathway
    101697360 (Pdgfra)
   04151 PI3K-Akt signaling pathway
    101697360 (Pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101697360 (Pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101697360 (Pdgfra)
   04540 Gap junction
    101697360 (Pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101697360 (Pdgfra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101697360 (Pdgfra)
   05206 MicroRNAs in cancer
    101697360 (Pdgfra)
   05230 Central carbon metabolism in cancer
    101697360 (Pdgfra)
   05231 Choline metabolism in cancer
    101697360 (Pdgfra)
  09162 Cancer: specific types
   05214 Glioma
    101697360 (Pdgfra)
   05218 Melanoma
    101697360 (Pdgfra)
   05215 Prostate cancer
    101697360 (Pdgfra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101697360 (Pdgfra)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101697360 (Pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101697360 (Pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hgl04090]
    101697360 (Pdgfra)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101697360 (Pdgfra)
Protein kinases [BR:hgl01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101697360 (Pdgfra)
CD molecules [BR:hgl04090]
 Proteins
  101697360 (Pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE DUF3475 Kinase-like
Other DBs
NCBI-GeneID: 101697360
NCBI-ProteinID: XP_004849765
UniProt: G5C9U9
LinkDB
Position
Un
AA seq 1089 aa
MGTSCPAFLVLGCLLTELSLILCQLPLPSILPNEDEKVVQLNSSFSLRCFGESEVSWKYP
MTPGDVPDVEIRNEENNSGLFVAVLEVANALAAHTGWYTCYYNHTQTEEGEVQGRHLYVY
VPDPDVAFLPLEMTDYIVLADTDDSAIIPCRTTDPKTPVTLHNSQGLVPASYNSKQGFNG
TFDMGPYFCEAIVRGKTFQTMLFNIVTLKAAPQLDLEMEALKTVYKSGETIEVTCAVFNN
EVVDLQWSYPGVVKGKGILKLQEIRFPTIKLVYTLTVPDATVKDSGDYECIARHATEDVK
EMKKVTISVHEKGFVEIRPTFGHKEAVNLHEVRHFVVDIQAYPPPRIAWLKDNLTLIENL
TEITTDVEKIREIRYRSKLKLIRAKEEDSGYYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSAGGQTVRCMAEGVPLPDIEWMICRDIKRCNNETSWTVLANNVSNIIMEIHPQG
RSIVEGRVTFAKVEETIAVRCVAKNLLGSGNRELKLVVPTLHSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSQHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADATQYVPMLERKEVSKYSDIQRSLYDRPVSYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYDIMMQCWNSEPEKRPSFYHLSEIVESLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNTYIGVIYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacatcctgcccggccttcttggtccttggctgtctcctcacagagctgagccta
atcctctgccagcttccactgccctccatccttccaaatgaagatgaaaaggtcgtgcag
ctgaattcatccttttctctgcggtgcttcggggagagtgaagtgagctggaagtacccc
atgactccaggagacgtccccgacgtggagatcagaaatgaggaaaacaacagcggcctt
tttgtggcggtgctggaagtggccaatgccttggcggcccacaccggctggtacacttgc
tactacaaccacacacagacggaggagggcgaggtccagggcaggcacctttacgtctat
gtgccggacccagatgtggcctttttgcctctagaaatgacagattacatagtcctcgca
gacaccgatgactctgccatcataccctgtcgcacaacagatcccaagactcccgtaacc
ttacacaacagccaggggctggtgccagcctcctacaacagcaaacagggttttaatggg
accttcgacatggggccctacttctgcgaggccattgtccgagggaagacgttccagaca
atgctgtttaatattgttactttgaaagctgcaccacagctggatcttgaaatggaagct
ctgaaaactgtgtataagtccggggaaactatcgaggtcacctgcgctgtctttaacaat
gaagtggttgaccttcaatggagttaccctggagtagtgaaaggcaaaggcatcctgaag
ctgcaggaaatcagatttccgaccatcaagttagtgtacactctgacggtccctgacgcc
acagtgaaagatagcggcgactatgaatgtatcgctcgtcatgccaccgaggatgtcaaa
gaaatgaagaaagtcaccatttccgtacatgagaaagggtttgttgagatcaggcctact
tttggccacaaggaagctgtcaacctgcatgaagtcagacattttgtggtggacatacag
gcctacccacctccccggatagcctggctgaaggacaacctgacactgattgaaaacctc
actgagatcaccactgatgtggaaaagattcgggaaataaggtatcgaagcaaactgaag
ctgatccgtgccaaggaagaagacagtggctattatactattgtggttcaaaatgaagac
gacgtgaagagctacacttttgaactgttaactcaagttccctcatccatcttggacctg
gttgatgaccaccatggctctgcagggggacagactgtgaggtgcatggctgaaggcgtt
cctcttcctgacattgagtggatgatctgcagggacattaagagatgtaataatgaaacg
tcttggacagttttggccaacaatgtctcaaatatcatcatggagatacatccccagggc
aggagtattgtggagggccgagtgacattcgccaaagtggaggagaccattgcagttcga
tgtgtggccaagaatctccttgggtctgggaaccgagagctgaagctggtggttcccacc
ttgcattctgaactcacggtggcagctgcagtcctggtgctgttggtgattgtgatcatc
tcactgattgtcctggttgtcatttggaaacagaaaccgaggtatgaaattcgctggagg
gtcattgaatcaatcagccctgatggacatgaatatatttatgtggacccaatgcaactg
ccttatgactccagatgggaatttccaagagatggactagtgcttggtcgcatcctggga
tctggtgcctttgggaaagtggtggagggaacagcatacgggctaagccgctcccagcct
gttatgaaggtggctgtgaagatgctcaaacccacagccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgactcacctgggaccacatttaaacattgtgaacttg
ctgggagcctgcaccaagtcaggccccatttacatcatcactgaatactgcttctatgga
gatttggtcaactatttgcataagaatagggatagcttcctgagtcagcacccggagaag
cctaagaaagaattggacatctttggattgaaccctgcagatgaaagcacaaggagctat
gtgattttatcttttgaaaacaatggtgactatatggacatgaagcaagctgatgccaca
cagtacgtccccatgctagaaaggaaggaggtttctaaatattcggatatccagagatcg
ctctatgatcgtcctgtctcatataagaagaaatctatgctagattcagaagtcaaaaac
ctcctctcggatgataactctgaaggccttactttgttggatttgttgagctttacctat
caagttgcccgaggaatggaatttttggcatcaaaaaactgtgtccaccgcgacctggct
gctcgcaatgtcctcctggcgcaagggaaaatcgtgaagatctgtgactttggcttggct
cgagacatcatgcatgattcgaactatgtgtcaaaaggcagtaccttcttgcccgtgaag
tggatggctcctgagagcatcttcgacaacctctacaccaccctaagtgacgtctggtct
tacggcattctgctctgggagatcttttctcttggtggcacaccctaccctggcatgatg
gtggattctactttctacaacaagatcaagagtgggtaccggatggccaagcctgaccat
gccaccagtgaagtctatgacatcatgatgcagtgctggaacagcgagccagagaagaga
ccctccttttaccacctgagtgagattgtggagagcctgctgccaggacaatacaaaaag
agttatgagaaaatccacttggacttcctgaagagtgaccatcctgctgtggcccgcatg
cgcgtggactcagacaacacatatattggtgtcatctacaaaaatgaggaagacaagctg
aaagactgggagggtggcctggatgagcagagactgagcgctgacagtggctatatcatc
ccgctgcccgacatcgatcctgtgcctgaggaggaagacctgggcaagaggaacaggcac
agctcacagacctctgaagaaagtgccattgagacaggttccagcagttccaccttcatc
aagagagaggacgagaccattgaggacatcgacatgatggatgacattggcatagactcc
tcagacctggtggaggacagcttcctgtaa

KEGG   Heterocephalus glaber (naked mole rat): 101697943
Entry
101697943         CDS       T02812                                 

Gene name
Il23r
Definition
(RefSeq) interleukin 23 receptor
  KO
K05065  interleukin 23 receptor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
hgl04659  Th17 cell differentiation
hgl05200  Pathways in cancer
hgl05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101697943 (Il23r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101697943 (Il23r)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101697943 (Il23r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101697943 (Il23r)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101697943 (Il23r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101697943 (Il23r)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL6/12 receptor family
   101697943 (Il23r)
SSDB
Motif
Pfam: fn3 IL12p40_C IL6Ra-bind
Other DBs
NCBI-GeneID: 101697943
NCBI-ProteinID: XP_004841539
LinkDB
Position
Un
AA seq 629 aa
MNQVAIQLDVSVALYVLFSWCHGGITKINCSGNIWVEPATVFKMGTNISVYCRAAIKNCQ
PRKLHFYINGIREQSHTSRINETTACQRYKNFLEPRASVYCTAECPGRLKETLVCGQDLS
SGYPPDAPEEVTCVVREHSGRMTCSWTAGRPTHLDTEFEVRVQSLETGEEQRYLASSYVD
ISTDALPAGRKYWVRVHAANVLGMEESKPLHVHLDDIVIPAASVISGAETLNATAPRTVV
HWKSETALEAVSCELRHKASDNHTWTVTEFDTNITYAHRSEFFLEPDVSYVFQVRCRGTG
KRYWQPWSAPFYHKTPATVPQVTPKSLQRDARDSDSGLLVASVLQSHLTSDNRQDVGLLS
GMLFFAIMLSILSLIGIFNRSLRTGIKRKILLLIPRWLREQIPNMENSNVVKMLQGKNEF
VNNNCSEQVLYVDPVITEIREIFLPEEQKPEDYRKEVNTEAQDLRASVFTKSTVVYVPDL
GAGYKPQSSNFLPGGNHVSSTDEIDPSTPQPTVDSLDLGKNPRFKNYPQFSFSVSSMNSL
SNTLILEELSLILNQGECRPPDVQNSDEDESTVLLESDSPSETLPNQTLLPDEFISCLGI
MNEELPSINPYFPQNILESHFSRISLLKK
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgaatcaggtggcaattcaactggacgtgtccgtagccctttatgtgctcttcagctgg
tgccatggaggaattacaaaaataaactgctctggcaacatctgggtagaaccagccacg
gtttttaaaatgggtacaaatatctctgtctattgccgagcagccattaagaattgccag
ccaaggaaacttcatttttatataaatggcatcagagaacaatctcacacctcaaggatt
aatgaaacaacagcttgtcagcggtacaagaacttcctggagccccgcgcctccgtgtac
tgcaccgcagagtgccctggacgtttgaaagagacgctggtgtgcggacaggacctttcc
tctggatatccgccggacgcccctgaggaggtgacctgtgtcgtccgtgaacactcgggc
cgcatgacgtgcagctggaccgcgggcaggcccacccacctggacacagagttcgaggtg
cgcgtgcagagtttggagacaggagaagagcaacggtatctcgcctcgagctacgtggac
atctccacagatgcgctgccagctggcaggaagtactgggttcgggtccatgctgcaaac
gtgctcggcatggaggagtcaaaacccttgcacgttcacctggatgacatagtgatcccg
gctgcgtccgtcatctccggggctgagaccctgaatgccacagctcccagaaccgtcgtt
cactggaaaagcgagacggcgctggaggctgtgtcctgtgagctgcggcacaaggcctcc
gacaaccacacatggacggtcacagaatttgacaccaacatcacatacgcacaccggtct
gaattcttcctggagccagacgttagctacgtatttcaagtgaggtgtcgaggaacaggg
aaaaggtactggcagccctggagcgcacctttttatcacaaaaccccagcgacagtcccc
caggtcaccccgaagtcgctgcagcgagatgctcgggactcggactccggtctcctcgtt
gcttctgtcttacaaagtcacctgacttccgacaacaggcaagatgttggacttctgtct
ggaatgctcttcttcgccatcatgctgtcgatcctctctttgattgggatatttaacaga
tcgctgcgaaccggaattaaaagaaaaatcttactgctgataccaaggtggcttcgtgaa
cagattcctaacatggagaacagtaatgttgtgaaaatgctacagggaaaaaatgaattt
gtgaataataattgcagtgaacaggtcctttatgttgatcccgtgattacagagataaga
gaaatttttctcccagaagaacaaaagcccgaagattacaggaaggaagtgaatacagaa
gcccaggacctgagagcatcagtattcaccaagagcactgtggtgtacgttcctgatctg
ggcgctggatacaagccccagagctcaaatttcctccctgggggaaaccatgttagcagc
actgacgaaatcgatccctcaacccctcaaccaacagtggactccttagacctaggaaag
aaccccaggtttaaaaactatcctcagttttctttttctgtctccagtatgaattcacta
agcaacacactaattcttgaagaattaagccttattctcaatcaaggtgaatgccgtcct
cctgacgtacagaactcagacgaggatgaaagcactgtgcttttagaaagtgattcaccc
agtgaaactctcccaaatcagactctactgccggatgaattcatctcctgcttggggatc
atgaatgaggagttgccgtctattaacccttactttccacaaaatatcttggaaagccac
ttcagtaggatttcactcttgaaaaagtag

KEGG   Heterocephalus glaber (naked mole rat): 101698371
Entry
101698371         CDS       T02812                                 

Gene name
Il22ra2
Definition
(RefSeq) interleukin 22 receptor subunit alpha 2
  KO
K05139  interleukin 22 receptor alpha 2
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101698371 (Il22ra2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101698371 (Il22ra2)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL10/28 receptor family
   101698371 (Il22ra2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 101698371
NCBI-ProteinID: XP_012923496
LinkDB
Position
Un
AA seq 230 aa
MPKHCFLGFLLSLFLTGGVGTQPAHDSLKPQRVRFQSRNFYNVLLWEPGWALTSNQSIYF
VQYKMYGERDWKSKKECWGTQELFCDLTNETSDLQELYYGRVQTASAGVYSGWSMTPRFI
PWWETKIEPPVINITRVNGLLSVVFHTPNPPYRDQKXKTISMENYYDLEYRVFIIKNSLK
MEQQVYEGPHRVVEIEGLIPRSGACIVAELYIPRFDRGSPRSAKRCVGAA
NT seq 693 nt   +upstreamnt  +downstreamnt
atgcctaagcattgctttctaggcttcctcctcagccttttcctgactggtggagtagga
actcagccagctcatgactctctgaagcctcagagggtacgatttcagtctcgaaacttc
tataatgttttgctctgggagcctgggtgggctctcaccagcaatcagagcatctatttt
gtgcagtacaaaatgtatggtgagagagactggaaaagtaagaaggaatgttggggtact
caggaactcttttgtgaccttacaaacgaaacctcagacctgcaggagctttactatggg
agggtgcagacggcctcggcaggggtttactctggatggagcatgacaccacgcttcatt
ccctggtgggaaacgaaaatagagcctccagtcataaatataaccagagttaatggattg
ttgtcggtggttttccatactccaaatccaccatatagagaccaaaaanggaaaactata
tcaatggaaaattactatgacctagaataccgagtttttataattaaaaattcactaaaa
atggaacaacaagtctatgaagggcctcacagagttgttgaaattgaaggtctcatacct
cgctctggtgcctgcatagtagctgaactatacatacccaggtttgacagaggaagccca
agaagtgcaaagagatgtgtgggggctgcataa

KEGG   Heterocephalus glaber (naked mole rat): 101698455
Entry
101698455         CDS       T02812                                 

Definition
(RefSeq) cytokine receptor common subunit beta-like
  KO
K04738  cytokine receptor common subunit beta
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04210  Apoptosis
hgl04630  JAK-STAT signaling pathway
hgl05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101698455
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101698455
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101698455
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101698455
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101698455
   04090 CD molecules [BR:hgl04090]
    101698455
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL3 receptor family
   101698455
CD molecules [BR:hgl04090]
 Proteins
  101698455
SSDB
Motif
Pfam: IL6Ra-bind fn3 IL4Ra_N Tissue_fac EpoR_lig-bind IL2RB_N1
Other DBs
NCBI-GeneID: 101698455
NCBI-ProteinID: XP_004845735
LinkDB
Position
Un
AA seq 845 aa
MALLPGPLLMALLALGWGNRVEGSEGTVPLQTLHCYNDYTSRIVCSWADTEAAGRLVNVT
LHWRLNEDHPQLVSCDLTKDMVWSHCPSPPCVPRRCVIPYQGFSLDKNGYFSFQPDRLLH
IQRTVTLAQHVQPPPPRDVQIYATGDQFLLTWSVALGGPKMSWLSQGDLEFEVVYKRLHE
SWENASTLHSSSSQVTLGPEILLPSSTYVARVRTRLAPHSSFSGRPSQWSREVHWDSQPG
DKAQPQNLQCVFDGAHVLSCSWEVRSQVTSSVSFGLFYRPSPDAGEEECPQVQKEELDGL
YTRQSCQIRVSSLRPHGQYMVAVRPRNEETFIKSSEHIQMAAPTLSMTKDGDRYTLHWEE
RNGRMTGPEIQVQHREDMATWEDSKTETLKNAHSMPLPPLQPATTYWDRVRVRPSPRDSY
DGIWSEWSKEQGWTTEWVLPPWVLTLILVFVTLALLLALRFCGLCGYRLNRKWKEKIPNP
SKSHLFQNGSAGLWLPDSMVAFVGRSAPHQGPGAGLFPELEGLCAVDHRDSEVSPLTTAD
PKVVCDPPSGSHSTPATTELPPEQPPSPQPGPPATQGRPEDQLATFDFNGPYLGPPHSCS
LPDLVGQRAPPQGPKPALPGPLEYLCLPLRGQVQLVPLAQVTGQGQAAHEECLPEPGTQA
SPFLEAGGGPAPPASEPRGQAQDPEVSPVVLPISSGGPEHLVLASGCVTTADLALTLSTG
ASSVSLASAPGLQNPCLCPGLPPTGPPTAPPPEKPGFEGYVDLPPTMGPLSTTPLGSPVP
SAPSSPVLSPGEPQADVALLSPTPEGLLVLQQVEDYCLPSSIGACQFPSQARPSVWARGS
SDELS
NT seq 2538 nt   +upstreamnt  +downstreamnt
atggcgctgctcccaggaccgctcctcatggccctgctggctctgggctgggggaaccgt
gtggaagggtcagaaggtactgtcccgctgcagaccctgcactgctacaacgactacacc
agccgcatcgtgtgcagctgggcggacaccgaggctgctgggcggctcgtcaatgtgacc
ctccactggcggttaaatgaggaccatccccagctagtgtcctgtgacctcactaaggat
atggtctggtcacactgcccatctcctccctgtgtgcctagaagatgtgtcattccctac
caaggtttcagcctggacaagaatggctacttctcattccagccagaccggcttctgcac
atccagcgcaccgtgacactggcccagcacgtgcagccgcccccaccccgagatgtccag
atctatgccactggggaccaattcctgctgacctggagtgtggccctcgggggtcccaag
atgtcctggctgtcacagggggacctggagtttgaggtggtctacaagaggcttcacgag
tcctgggagaatgccagcaccctgcactccagctcttcccaggtcaccctggggcccgaa
atcctcctgcccagcagcacctatgtggcccgagtgcggacccggctggccccacactcg
agcttctcagggcggcccagccagtggagccgtgaggttcactgggactcacagccaggg
gacaaggcccagccccagaacctgcagtgtgtctttgatggggcccacgtgctcagctgc
tcctgggaggtgaggtcccaggtgaccagctcggtctccttcggcctcttctacaggccc
agcccggatgcaggggaggaggagtgtccccaagtgcagaaggaggagcttgacggcctc
tacacccgccagtcctgccagatccgtgtctccagcctgaggccccacggccagtacatg
gtggccgtgcgcccacggaatgaagagacattcatcaagagctcagagcacatccagatg
gcagccccaaccctcagcatgaccaaggatggagacaggtacaccctgcactgggaagaa
aggaatggacgcatgacaggtccggagatccaggtccagcacagggaagacatggccacg
tgggaggacagcaagactgagaccctgaagaacgcgcacagcatgccgctgccccccctg
cagcccgccaccacctactgggacagggtgagggtcaggcccagccccagagacagctac
gacgggatctggagcgagtggagcaaggagcagggctggaccactgagtgggtgctgcct
ccctgggtgctgacactcatcctggtctttgtcaccctggccctgctcctggccctgcgc
ttctgtgggctctgtgggtacaggctgaacaggaagtggaaggagaaaatccccaacccc
agcaagagccacctcttccagaatggaagcgcagggctctggctcccagacagcatggtg
gccttcgtgggcaggagcgcccctcaccaggggcccggggctggcctcttccctgagctg
gaggggctgtgcgctgtagatcacagggacagtgaggtgtcacctctcaccacagcggac
cctaaagttgtctgtgaccctccatccgggtctcattccactccagccaccacagaactg
cctccagaacagccccccagccctcagccaggcccaccagccacccaaggccggcctgag
gaccagctcgccaccttcgacttcaatggcccctacctcgggccgccacacagctgctcc
ctgcctgacctcgtgggccagcgtgcacccccacaggggcccaagccagccctgccaggc
cccctggagtacctgtgtctgcccctcagggggcaggtgcagctggtgcctctggcccag
gtcacagggcagggacaggctgcccatgaggaatgtctgcctgagcctggcacccaggcc
agccccttcctggaagctgggggaggccctgcccctcctgcatctgagcccaggggccag
gcacaggacccagaggtcagcccagttgttcttcccataagctctgggggccctgagcac
ctggtcctggcctctggttgtgtcaccactgcagacctggcactcaccttgtccacaggg
gcctcatctgtctccctggcctccgctccaggcctccagaacccctgcctctgtccaggg
ctgccccccacagggccccccaccgccccaccccccgagaagccagggtttgagggctat
gtggatcttcctccaaccatggggccactgtccacaacccctctgggcagtcctgtccct
tctgcacccagcagccctgtcctgagcccaggggagccccaggcagatgtggccctgctg
tccccaactcctgaggggctccttgtcctgcagcaggttgaggactactgcctcccctcc
agcatcggagcctgccagttcccttcccaggccaggccctctgtttgggcaagggggagc
tcagatgaattatcctag

KEGG   Heterocephalus glaber (naked mole rat): 101698624
Entry
101698624         CDS       T02812                                 

Gene name
Ifnlr1
Definition
(RefSeq) interferon lambda receptor 1
  KO
K05140  interferon lambda receptor 1
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101698624 (Ifnlr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101698624 (Ifnlr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101698624 (Ifnlr1)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL10/28 receptor family
   101698624 (Ifnlr1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 101698624
NCBI-ProteinID: XP_012929689
LinkDB
Position
Un
AA seq 334 aa
MSGPGPWAPLLLCLLQAAQGRPYLAPPQNVTLFSQNFSVYLTWLPGLGNPQNVTYFVAYQ
SFSTLTRWQRVGNCSGTSALVCPLMCLKKQDLYIKFKGRVQVASASARSPWAESQYLDYL
FEVELGPPILVVTLREKILSINATYQLPPCTPTLDLQYEVQFWKEGIGNKTLFPATAHGQ
PIQILLQPLARGCHCLSARTIYTLISPKYSSFSEPHCLSLGAPGANWTDLVLCSLPLLFL
VVVIAGVMWKNLKGDPWFHGVKTPRALDFSGYRHPLAAFQRGGPESLDELFLCPQKKLTG
RVRLAPPVRAPATLQSGSEDSAADEEDEDTDDRT
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtcggggcccggcccgtgggcgcccctgctcctctgcctgctgcaggccgctcaaggg
agaccctatctagcccctccccagaatgtgaccctgttctctcagaatttcagtgtgtac
ctgacgtggctcccaggtctgggcaacccccagaatgtgacctattttgtggcctatcaa
agcttttccaccctgacacgatggcaaagagtgggaaactgttcaggaacctcggcactg
gtgtgtcccctgatgtgcctgaagaaacaggacctgtacatcaagttcaagggacgcgtg
caggtggcctctgccagtgccaggtccccctgggctgagtcccagtacctggattacctt
tttgaagtggagctgggcccgcccatcctggtggtcactctgagggagaagatcctgagt
atcaatgccacctaccagctgccgccttgcacacccaccctggatctgcagtatgaggtg
caattctggaaggagggcattggaaacaagaccctatttccagccactgcccatggccag
cccatccagatcctgctccagcctttggcccgcggatgccactgcctcagcgccagaacc
atctacaccctcatctcccccaagtacagcagcttctcagagccccactgcctctctctg
ggggccccaggggccaactggacagacctggtactgtgctcactcccgctactgttcttg
gtagttgtcatagcgggtgtgatgtggaagaacctgaagggcgacccctggttccatggg
gtgaagacaccgagggccctggacttttcgggatacagacacccgctggcagcctttcag
cggggtggaccagagtccttggatgagttattcctctgtccccaaaagaagctgactggt
agggtcaggctggcccctccagtcagggccccggccaccctgcagtcgggatcagaggat
agcgctgcagatgaggaggatgaggacacagatgacaggacctga

KEGG   Heterocephalus glaber (naked mole rat): 101698831
Entry
101698831         CDS       T02812                                 

Gene name
Csf2rb
Definition
(RefSeq) cytokine receptor common subunit beta
  KO
K04738  cytokine receptor common subunit beta
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04210  Apoptosis
hgl04630  JAK-STAT signaling pathway
hgl05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101698831 (Csf2rb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101698831 (Csf2rb)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101698831 (Csf2rb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101698831 (Csf2rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101698831 (Csf2rb)
   04090 CD molecules [BR:hgl04090]
    101698831 (Csf2rb)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL3 receptor family
   101698831 (Csf2rb)
CD molecules [BR:hgl04090]
 Proteins
  101698831 (Csf2rb)
SSDB
Motif
Pfam: fn3 IL6Ra-bind Tissue_fac IL4Ra_N IL2RB_N1 EpoR_lig-bind
Other DBs
NCBI-GeneID: 101698831
NCBI-ProteinID: XP_004921140
LinkDB
Position
Un
AA seq 853 aa
MALLPGPLLMALLALGWGTRVEGSEGTVPLQTLHCYNDYTSRIVCSWADTEAAGQLINVT
LHRRLKGDHPQPVSCDLTKDMPWSHCPSPPCVPRRCVIPYQGFVLADNDYYSFQPDRLLH
IQRTVTLAQHVQPPPPRDVQIYATGDQFLLTWSVALGGPKMSWLSQGDLEFEVVYKRLHE
SWENASTLHSSSSQVTLGPEILLPSSTYVARVRTRLAPHSGFSGRPSQWSREVHWDSQPG
DKAQPQNLQCVFDGAHVLSCSWEVRSQVTSSVSFGLFYRPSPDAGEEECPQVQKEELDGL
YTRQSCQIRVSSLRPHGQYTVAVRPRNEETFIKSSEHIQMEAPTLNVTKAGGSYSLRWEA
KRMYYSHIENIFQVQYRKDKEEWEDSKTETLKNAHSMPLPPLQPATTYWARVRVRPSPRD
SYDGIWSEWSKEQGWTTERVLPPWVLTLILVFVTLALLLALRFCGLCGYRLNRKWKEKIP
NPSKSHLFQNGSARLWLPDSMVAFAGRSAPRQGPRAGLFPELEGLCAVDHRDSEVSPLTT
EDPKVVCDPPSGSRSTLAASDLTPEQVPSPQPGPPATQGRPEDQLATFDFNGPYLGSPHS
CSLPDLAGQRAPPQGPKPALPGSLEYLCLPPGGQVQLVPLTQVTGQGQAAHEEVGGGPAP
PASEPRGQAQDPEDSPAILPTSSEGPEHLVLASGYVTTADLALTLSTGASSVSLAPALGL
QDPCLCPGLPPAGPPITPLPEKPGFEGYVELPPTMGAPPMSLLGSPASSNPVLSPGEPRA
DVPLPSPTPEGLLVLQQVGDYSFFPGLGPGPFSPRSKPSSPGPCPERADIERGSTVQKPP
DQPVPQVPAIQFF
NT seq 2562 nt   +upstreamnt  +downstreamnt
atggcgctgctcccaggaccgctcctcatggccctgctggctctgggctgggggacccgt
gtggaagggtcagagggtactgttccgctgcagaccctgcactgctacaacgactacacc
agccgcatcgtgtgcagctgggcagacaccgaggctgctgggcagctcatcaatgtgacc
ctccatcgcaggttaaaaggggaccatccccagccagtgtcctgtgacctcactaaggat
atgccctggtcacactgcccatctcctccctgtgtgcctagaagatgtgtcattccctac
caaggtttcgtcctggccgacaatgattactactcattccaaccagaccggcttctgcac
atccagcgcaccgtgacactggcccagcacgtgcagccgcccccaccccgagatgtccag
atctatgccactggggaccaattcctgctgacctggagtgtggccctcgggggtcccaag
atgtcctggctgtcacagggggacctggagtttgaggtggtctacaagaggcttcacgag
tcctgggagaatgccagcaccctgcactccagctcctcccaggtcaccctggggcccgag
atcctcctgcccagcagcacctatgtggcccgagtgcggacccggctggccccacactcg
ggcttctcagggcggcccagccagtggagccgtgaggttcactgggactcacagccaggg
gacaaggcccagccccagaacctgcagtgtgtctttgatggggcccacgtgctcagctgc
tcctgggaggtgaggtcccaggtgaccagctcggtctccttcggcctcttctacaggccc
agcccggatgcaggggaggaggagtgtccccaggtgcagaaggaggagcttgacggcctc
tacacccgccagtcctgccagatccgtgtctccagcctgaggccccatggccagtacacg
gtggccgtgcgcccacggaatgaagagacattcatcaagagctcagagcacatccagatg
gaggccccgaccctcaacgtgaccaaggctggaggcagctacagcctgcgctgggaggcg
aagagaatgtactattcccacatcgagaacatcttccaggtccagtaccggaaagacaag
gaggagtgggaggacagcaagactgagaccctgaagaacgcgcacagcatgccgctgccc
cccctgcagcccgccaccacctactgggccagggtgagggtcaggcccagccccagagac
agctacgacgggatctggagcgagtggagcaaggagcagggctggaccactgagcgggtg
ctgcctccctgggtgctgacactcatcctggtctttgtcaccctggccctgctcctggcc
ctgcgcttctgtgggctctgtgggtacaggctgaacaggaagtggaaggagaaaatcccc
aaccccagcaagagccacctcttccagaatggaagtgcaaggctctggctcccagacagc
atggtggccttcgcgggcaggagcgcccctcgccaggggcccagggctggcctcttccct
gagctggaggggctgtgcgctgtagatcacagggacagtgaggtgtcacctctcaccaca
gaggaccctaaagttgtctgtgaccctccatccgggtctcgttccactctggctgcctca
gacctgaccccagaacaggtccccagccctcagccaggcccgccagccacccaaggccga
cctgaggaccagctcgccaccttcgacttcaatggcccctaccttgggtcgccacacagc
tgctccctgcctgacctcgccggccagcgtgcaccaccacagggccccaagccagccctg
ccaggctccctggagtacctgtgtctgccccccgggggacaggtgcagctggtgcctctg
acccaggtcacagggcagggacaggctgcccatgaggaagtagggggaggccctgcccct
cctgcatctgagcccaggggccaggcacaggacccagaggacagcccagctattctgccc
acaagctctgagggccctgagcacctggtcctggcctctggttatgtcaccactgcagac
ctggcactaaccttgtccacaggggcctcatctgtctccctggcccccgctctgggcctc
caggacccctgcctctgtccaggcctgccccccgcagggccccccataaccccactccct
gagaagccaggatttgagggctatgtggagcttcctccaaccatgggggcaccccccatg
tcccttctgggcagtcctgcatccagcaaccctgtcctgagcccaggggagccccgggca
gatgtgcccctgccgtccccaactcctgaggggctcctggtcctgcagcaggtaggggac
tacagcttcttccctggcctaggacctggccccttctcaccccgaagcaaaccctcttcc
ccaggaccctgtccggagagagcagacattgagcggggttccacagtccagaaacctcca
gaccagcctgtaccccaggtgcctgccattcagttcttttaa

KEGG   Heterocephalus glaber (naked mole rat): 101699117
Entry
101699117         CDS       T02812                                 

Gene name
Il20ra
Definition
(RefSeq) interleukin 20 receptor subunit alpha
  KO
K05136  interleukin 20 receptor alpha
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04061  Viral protein interaction with cytokine and cytokine receptor
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101699117 (Il20ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101699117 (Il20ra)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101699117 (Il20ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101699117 (Il20ra)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL10/28 receptor family
   101699117 (Il20ra)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind GSG-1
Other DBs
NCBI-GeneID: 101699117
NCBI-ProteinID: XP_004871584
LinkDB
Position
Un
AA seq 501 aa
MKNVLHWNPPESLQGVEVMYAVQYFIYGQKRWLNKPECKNISRTYCDLSDETSDYEHQYY
AKVKAIWETNCSKWTEMGRFYPFLETQTGPPKVALTTDEKSISIVLTAPDKWKRNPEDCT
ISMQQIYSNLKYIVSVYNIKSKRTWSQFVTSPTLVLSCLEPNTLYCVQVESFVPEPPRPA
QPSQKQCISTSEDPTSALKVKIILWYVLPTSVIVFLFSVIGYSIYRYIHVGKEKHPDNLI
LIYGNELDKRVFVPAEKIMINFITLNVLDDSKIPQKDMIRLDKSSDGSKLRDPKPLWNLE
SPPEEVEVKHLEYTPHLVGIFCNSEENTRATSLTKQESLTSTTAAGEAVVEYXCDVRTDI
HGGSEDHQFSTQEGASIQGKLFQQQAALASLGPPMLCSYRPQLSDLHHLAQERSASEEGL
EEESSTTLVDWDPRTGKLCIPSLSSFDQDPEGSEHSESDGLTEEGLLSRLYKEQVPAKTE
EDENYVLQFTEEWGLYVPMES
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgaagaatgtcctacactggaatcctccagaaagtctacaaggagttgaagttatgtac
gctgtgcagtatttcatatatgggcaaaagagatggctgaataaacctgaatgcaagaat
atcagtaggacctactgtgatctttctgatgaaacatctgactatgaacaccaatattat
gccaaagtaaaggccatttgggaaacaaattgttccaaatggaccgaaatggggcgattc
tacccttttttagaaacacaaactggtcccccaaaggttgccctaactactgatgagaag
tccatttctattgtcctgacggctccagacaaatggaaaagaaatccagaagactgtacc
atttccatgcaacaaatatactccaatctgaagtacattgtgtctgtatataacatcaaa
tccaaaagaacatggtcccagtttgtcaccagccccacgctggtgctcagctgcctggag
cccaacactctgtactgtgtccaggtggagtcttttgtcccagagcccccgcgccctgct
cagccttctcagaagcagtgtatcagtacttcggaagatccaacatcagcattgaaggtt
aaaatcattttgtggtatgttttgcccacatctgtgatcgtgtttctattttctgtgatt
ggctactccatctaccgctatatccatgttggcaaagagaaacacccagataatttgatt
ttgatttatggaaatgaacttgacaaaagagtctttgtgcctgctgaaaaaatcatgatt
aacttcatcaccctcaatgttttggatgattctaaaattcctcagaaggatatgattcga
ctggacaaaagcagtgatggatccaaactcagggatcccaagcccctctggaacttggag
tcccctccagaggaagtggaggtgaaacacttggagtacaccccacatttggtgggaatt
ttctgtaactcggaggaaaacaccagagctacttccctgaccaagcaagagtcgctcacc
agcacaacagctgcaggcgaagctgtggttgaatattagtgtgatgtaagaactgacatt
catgggggatctgaagatcaccagttcagtacacaggagggggcatccatacaaggaaaa
ttatttcagcaacaggcagctttggcaagcttgggtccaccgatgttgtgctcctatagg
cctcagctcagtgacttacaccacctggcacaggagcgctctgcctcagaagagggacta
gaggaggagtcgtcgacgaccctggttgactgggaccctcggactggcaagctatgtatc
ccttccttatctagctttgaccaggaccccgagggcagcgagcatagtgagtctgatggt
ctcacagaggaaggcctgctgtccagactctacaaggagcaggtaccagccaagacagaa
gaagatgaaaactatgtcctgcaatttacggaggagtggggactgtacgtgccaatggaa
agctaa

KEGG   Heterocephalus glaber (naked mole rat): 101699944
Entry
101699944         CDS       T02812                                 

Gene name
Il27ra
Definition
(RefSeq) interleukin 27 receptor subunit alpha
  KO
K19598  interleukin 27 receptor alpha
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
hgl04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101699944 (Il27ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101699944 (Il27ra)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101699944 (Il27ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101699944 (Il27ra)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL6/12 receptor family
   101699944 (Il27ra)
SSDB
Motif
Pfam: fn3
Other DBs
NCBI-GeneID: 101699944
NCBI-ProteinID: XP_004872599
LinkDB
Position
Un
AA seq 632 aa
MRGPRAASLRPLSLLSLVVALLPGTRAQGSAGLLQCFRVGSQRNLNCSWEPLPDSRNPIV
LHFQSRKYHSNRTQTVAVPAGQSWGTIARKKFTEADHLLVWGTQGGRPLWTPVLVDLETR
VKPDTPHLLPGGVDFSEDAPLEATVQWQPPEWPSKPLICQFYYQRCLEQGWSLLEPEVKT
VPLSPVEMQELELTSAYKVRGRCRVETKGDLWSEWSQALHFQTPPAAPKDVWIAGNPCMT
PGSPAALLVWKAPGPCVQVSYQVWFWAGEKMQMQEEVPCCSWPIPAWARWARVSAKDGVP
WVPSTNLSLFCLAADSAPQNVVVSSIAGTPGLLVSWQQGTQEPWEYVVAWALDGKALEDV
SWTRISLGNHSAVLLGNFTRGVPYHISVTAVFPEGLAPAPSVWGFGEELAPVAGPAVWRL
PDDPLGTPAVAWGELSKHQLRGHLSHYTWCARSGSRASVCVNVSSSTRKVTLPELPWGPC
KLWVMAATIAGQGPPGPSLQFHLPGNTLSWGVLPRILCPWALFLLVCCLGLATSGRCLHL
RHKVLPRWVLEKVPDPANSHSGHPHIEQVLQPQPQPQAPGDVPILEVEEIEPMPLIEPPQ
ASTPVHSGYEKHFMPTLEELSLLGPPSPHVLA
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgaggggcccgcgggctgcctccctccggccgctgtcgctgctgtcgctggtagtggcg
ctactccctgggactcgcgcccagggcagcgcggggctgctgcagtgctttagagtcgga
tcccagcggaacctgaactgctcctgggaaccgctcccggactccagaaaccccatcgtc
ctgcacttccaaagccggaagtaccactccaacagaacccagacagtggcagtgcccgcg
gggcagagttgggggaccattgctcggaagaagttcaccgaggcggaccatctgctggtc
tgggggactcaagggggcaggcctctctggacaccggtcctcgtggacctggaaacccga
gtgaagcccgacaccccccatctgttacccggtggcgtggacttctcagaggatgcaccg
ctggaggctaccgtgcagtggcagccacctgaatggccatccaagcccctgatctgtcag
ttctactatcagaggtgcctggagcaaggctggtccctgctagagccggaagtgaagact
gtgcctctgagcccggtggagatgcaggagctggagctcacctcggcctacaaagtgcgt
ggacgctgcagagtggagaccaaaggagacctgtggagcgagtggagccaggccctgcac
ttccagaccccgcccgctgcccctaaggacgtatggatcgctgggaacccgtgcatgacc
ccaggcagcccggcagccctgctggtgtggaaggctccggggccctgcgtgcaagtgagc
taccaagtgtggttctgggctggagagaagatgcagatgcaggaggaggtgccctgctgt
tcgtggcccatccctgcctgggcacggtgggccagggtgtctgccaaggatggtgtcccc
tgggtgccctccaccaacctctccttgttctgcttggctgcagactctgcgccccagaat
gtggtggtcagcagcattgctgggacccccggactgctggtgagctggcaacaggggacc
caggagccatgggagtatgtggtggcctgggccctggacggaaaagccctggaggatgtc
agctggacccggatttctctggggaaccacagtgctgtgctgctaggcaattttacaaga
ggggtcccctatcacatctcggtgacagcagtctttcctgagggcctggcccctgctccc
tctgtctgggggtttggagaggagctagcacctgtagcgggtccagcagtttggcggctc
ccggatgaccccttggggacccccgcagtggcctggggagagctctcaaagcatcagctc
cggggccacctctcccactacacctggtgtgcacggagtggctccagagcctcagtctgt
gtgaacgtgagcagcagcacccggaaggtcactctgcccgaactcccctggggaccctgc
aagctgtgggtgatggcggccaccattgcgggacaaggcccacctggtcccagcctccag
tttcacctgccagggaatactttgagctggggagtcctgccccgaatcctgtgcccatgg
gccttgttcctgttggtctgctgcctgggcctggccacctctggaaggtgccttcacctg
agacacaaggtattgccccgatgggtcttggagaaagttcctgatcctgccaacagccat
tctggccacccccacatagagcaggtgctgcagccccagccccagccccaggcccctggg
gatgtgcccatcctggaggtggaagagatagagccgatgccgcttatagagccaccccag
gcctccaccccagttcactctgggtatgagaaacacttcatgcctacactggaggagctg
agccttctggggccccccagtccccatgtgctggcctga

KEGG   Heterocephalus glaber (naked mole rat): 101701153
Entry
101701153         CDS       T02812                                 

Gene name
Il5ra
Definition
(RefSeq) interleukin 5 receptor subunit alpha
  KO
K05067  interleukin 5 receptor alpha
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
hgl04640  Hematopoietic cell lineage
hgl05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101701153 (Il5ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101701153 (Il5ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101701153 (Il5ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101701153 (Il5ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101701153 (Il5ra)
   04090 CD molecules [BR:hgl04090]
    101701153 (Il5ra)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL3 receptor family
   101701153 (Il5ra)
CD molecules [BR:hgl04090]
 Proteins
  101701153 (Il5ra)
SSDB
Motif
Pfam: IL6Ra-bind Tissue_fac LIFR_D2 fn3 EpoR_lig-bind
Other DBs
NCBI-GeneID: 101701153
NCBI-ProteinID: XP_004854281
LinkDB
Position
Un
AA seq 416 aa
MVPALLILLGAMETLQTDLFPDKTFLLLPPVNFTIKVTGLAQVLLCWEPNPDQGQRTDTV
KYHVKINAPQQEDYETRNSESKCETTLHQGFSASVRTILWRDHSFLASSWVSAEHKAPPG
SPGTSIVNLTCTTNTAAGNFTDLLKSYQVSLHCTWLAGKDAPEDTQYFLYYRYGPWTEEC
QKYSKDTLNRNTACWFPRTFIHSKARDRLAVHVNGSSKHAAIKPFDQLFDTQAIDQPNPP
MNVTAETEGSRLSIQWEKPVSAFPIHCFDYEVKIYNTKGYYQVEKTTTNAFVSTTDGVSK
YSIQVRAAVSTACRAMGLWSKWSQPIYVGNEQKPITEWFLIMLTATICFVLLIFLFLCRI
YHLWTKLFPPVPAPRSNIKDLIVTNNCEKAGSSETEIEGISYVEEPVFEILENSVF
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggtgcctgccttactgatccttttgggggccatggagactctgcaaacagacttattt
cctgacaaaacatttttacttctcccacctgtgaatttcaccattaaagttactggttta
gctcaagttcttttatgttgggaaccaaatcctgatcaaggacaaaggactgacactgta
aaatatcatgtgaaaataaatgccccacaacaagaggattatgaaaccagaaactctgaa
agcaaatgtgaaaccacccttcatcaaggcttttcagcaagtgtgcgtaccatcctgtgg
agggaccactcctttctggccagcagctgggtttctgctgaacataaagccccaccagga
tctcctggaacctcaattgtgaatttaacttgtaccacaaacactgcagcaggtaatttt
acagacttattaaagtcatatcaagtttctcttcattgcacctggcttgctggcaaggat
gcccctgaggacacacagtatttcctctattataggtatggcccttggactgaagaatgt
caaaaatacagcaaggatacactcaacagaaatactgcatgctggttcccaaggactttc
attcatagcaaagcacgtgacaggcttgcagtgcatgttaatggctcaagcaaacatgct
gcaatcaagccctttgatcagctgtttgatacacaagccattgatcaaccaaatcctcca
atgaatgtcacagcagagactgaaggatctcgtctctccatccaatgggagaaaccagtt
tctgcctttccaattcattgctttgattatgaagtgaaaatttacaatacgaagggttat
tatcaggtggaaaagacaacaaccaatgcatttgtctccacaactgatggtgtttctaag
tactccattcaagtgagagcagctgtgagcaccgcatgtagagccatggggctatggagc
aagtggagtcaacctatttatgtgggaaatgagcagaagcccatcacggaatggtttctc
atcatgcttacagcaaccatctgctttgtgttattaattttcttattcctctgcagaata
tatcacttatggaccaagttgtttccaccagttccagcaccaagaagtaacatcaaagat
ctcattgtgaccaataactgtgagaaagctggttccagtgaaacagaaattgaaggcata
agttatgtagaagagcctgtatttgaaatcttggaaaattctgtgttttga

KEGG   Heterocephalus glaber (naked mole rat): 101701307
Entry
101701307         CDS       T02812                                 

Gene name
Il21r
Definition
(RefSeq) interleukin 21 receptor
  KO
K05075  interleukin 21 receptor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
hgl04659  Th17 cell differentiation
hgl05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101701307 (Il21r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101701307 (Il21r)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101701307 (Il21r)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    101701307 (Il21r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101701307 (Il21r)
   04090 CD molecules [BR:hgl04090]
    101701307 (Il21r)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL2 receptor family
   101701307 (Il21r)
CD molecules [BR:hgl04090]
 Proteins
  101701307 (Il21r)
SSDB
Motif
Pfam: IL4Ra_N
Other DBs
NCBI-GeneID: 101701307
NCBI-ProteinID: XP_004856328
LinkDB
Position
Un
AA seq 537 aa
MQLPGWAAAWLLLMLQSGWGCPDLDCYTDYLQTVACLAAMQPLRSHRLSLTWQDPNMELQ
DEVTFCSLHRSSHNATHATYTCHMDVFRFLADDIFTVHMTDASAGDSQECGSFLLAERIK
PAPPFNVTVTFSGLYNVSWRSDYEEPIFYALQGKLQYELQYRNRADPWALSPVTKLISVD
SRSVSLLPGEFRKNSSYELQVRAGPQPGSFFGGTWSEWSDPVIFHTQPEEPKAGWDTGLL
LLLLSLVVLVPPAIVFVGLKIHLPWRLWKELWAPVPSPERFFQPLYEGHRGDFKKWVGTP
FTASSLQLAPWGPAAPSILEVPDCQTSWNLAKELEALGLPGPADLLESDGAPEPRSSSED
GSPRGSDYGEEKDRPYGLVSLDTVTVVDAEDVCAWPCRCGDDGYPALDLDTGLEPGPSPG
DLLLDSGATVLSCGCVSAGGPGLGGALGSRLDRPKLSPTGEEGWASEPPWAGPSAGSVSG
SEAGSPPAGLDMDTFDSGFAGSDCGSPVECDTGPPRSYLRQWVISEPMPEGTEPQAS
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgcaactgcctggctgggccgctgcctggctcctgctgatgctccagagtggatggggc
tgtccagacctcgactgctacaccgattacctgcagacggtcgcctgcctggcagcgatg
cagcccctgcgctcccacaggctctctcttacctggcaagacccaaacatggagctgcag
gacgaggtcaccttctgcagcctgcacagatccagccacaacgccacacatgccacgtac
acgtgccacatggatgtgttccgcttcctggctgacgacatttttacggttcacatgacg
gatgcgtctgccggtgactcccaggagtgcggcagcttcctgctggctgagagaatcaag
ccggctcctcccttcaatgtgactgtgaccttctcgggactctataatgtctcctggcgc
tccgattacgaagagcccatcttctacgcgctgcagggcaagctgcagtacgagctgcag
tacaggaaccgcgcggacccctgggcgctgagcccggtgacaaagctgatctcagtggac
tccagaagcgtttccctcctcccgggggagttccgaaaaaactcaagctatgagctgcag
gtgcgggcgggacctcagcctggctccttcttcggggggacgtggagcgagtggagtgac
cccgtcatctttcacacccagcctgaagagcccaaggcaggttgggacactggcctgctg
ctcctgctcctgtccctggttgtcctggttcccccggccattgtcttcgtgggcctgaag
atccacctgccctggaggctgtggaaagagctgtgggcgcccgtgcccagcccggagcgg
ttcttccagcccctgtatgagggccacagaggagacttcaagaagtgggtgggaaccccc
ttcactgcctccagtctgcagctggcaccctggggcccagcagcgccgtccatcctggag
gtgcctgactgccagacgtcctggaacctggccaaggagctggaggccctcggcctgccg
gggcccgcagacctgctggagtccgacggggcacctgagcccaggtcctcctccgaggat
ggcagccctcgaggctcagactacggcgaggagaaggaccggccgtacggcctggtgtcc
ctcgacactgtgacggtggtggacgcggaggacgtgtgcgcctggccttgccgctgtggg
gatgatggctacccggccctggacctggacactgggctggagcccggccccagcccgggg
gacctgctcctcgattcgggggccacagtcctctcctgcggctgcgtctcagcagggggc
cccgggctgggcggggctctgggcagccggctggacaggccgaagctgtcccctacgggg
gaggagggctgggcctcggagccaccctgggccgggccgtcagcaggcagcgtctctggg
agcgaggcgggctcgccccccgctgggctggacatggacacattcgacagcggttttgcg
ggctccgactgcggcagcccggtggagtgtgacacagggcccccccggagctacctccgc
cagtgggtgatctcggagcccatgcctgagggcaccgagccccaggccagctag

KEGG   Heterocephalus glaber (naked mole rat): 101702063
Entry
101702063         CDS       T02812                                 

Gene name
Crlf2
Definition
(RefSeq) cytokine receptor-like factor 2
  KO
K05078  thymic stromal-derived lymphopoietin receptor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101702063 (Crlf2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101702063 (Crlf2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101702063 (Crlf2)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL2 receptor family
   101702063 (Crlf2)
SSDB
Other DBs
NCBI-GeneID: 101702063
NCBI-ProteinID: XP_004867362
LinkDB
Position
Un
AA seq 428 aa
MGTHVWARAAAAILLQLLLGDPTAPEDTGAGETLQVHIICFNFEMVQVTWNNTVPATGTN
LTFFYRFQDDQPYAPCTRYLVRCGLTAGCLVEGGDRVLDFCLHNGSRRVLAMQRWVSDYL
KPRAPRDLRFLWGQDAVTVTCPGLPYSGLLYEVQHRTPYDGGWQSRVAELCNVTIEGLDL
GHCHSFRARVLTQASSYGSEASPSDWSPVTHWQGAAPRDSCLQWPPLPKWPRFFLVCSLV
SLLTVALLLLAVCKAQRVKRVLMPSVPDPKGSFPGLFEHHQGDFQTAEERNAWEMFCHAP
PCCHGPCGRTDGRTDGSHVMLRCTRQPSRKNGAAPRENEWITDTQDVAPWKKPPSGEQDP
GSEQTLEVHVSRVDAELPLVTRPLSPHTREEEASVGSAQHPPRDPQGGTVVSLAGFTFMM
TDNAYMKL
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggggacccacgtgtgggctcgggcagccgctgccatcctgctgcagctgctgctgggg
gacccgacggccccagaggacacaggagccggagaaactctgcaggttcatatcatctgc
ttcaactttgaaatggtgcaggtgacctggaacaacaccgtacctgctacagggaccaac
ctgactttcttctacaggttccaggacgaccagccgtacgcgccgtgcacccgctacctg
gtccggtgcggcctcacggccgggtgcctcgtggaagggggcgaccgggtcttggacttc
tgcctccacaacgggtcgcgccgtgttctcgccatgcagcgctgggtctccgattacctg
aagcccagggccccgcgagacctgcggttcctgtggggacaggacgctgtcaccgtgacg
tgccccggcctgccctacagtgggctgctctacgaggtgcagcacaggacgccttacgac
ggcgggtggcagtccagggtggcggagctgtgcaacgtgaccatcgagggcctggacctg
gggcactgccactccttccgggccagggtgctgacccaggcgtcctcctacggctccgaa
gcatcccccagcgactggtctccggtcacccactggcagggagctgcgccccgagattcc
tgcctgcagtggcccccgctgcccaaatggccccggttcttcctggtgtgcagcctggtg
tcgctcctgaccgtggccctgctgctcctggctgtgtgcaaggcgcagagggtgaagagg
gtgctgatgcccagcgtgccggaccccaagggctcctttcccgggctgttcgaacaccac
cagggggacttccagacagcagaggagagaaacgcgtgggaaatgttctgccatgctcct
ccatgctgccacgggccctgtggacggacggacggacggacggacggatcgcacgtgatg
ttgcgatgcacaaggcagccctcacggaagaacggcgcagccccccgagagaatgagtgg
atcaccgacacccaggacgtggccccatggaagaagccgccgagcggggagcaggaccct
gggtctgagcagacgctggaggtccatgtgtccagggtggacgcggagctgcccctggtg
acgaggcccctgtccccacacacaagggaggaagaggcctccgtgggctccgcgcagcac
cctccccgagacccccagggtggcaccgtggtctctcttgcgggcttcacgttcatgatg
acggacaacgcctacatgaagctgtga

KEGG   Heterocephalus glaber (naked mole rat): 101702338
Entry
101702338         CDS       T02812                                 

Gene name
Il12rb1
Definition
(RefSeq) interleukin 12 receptor subunit beta 1
  KO
K05063  interleukin 12 receptor beta-1
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl05200  Pathways in cancer
hgl05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101702338 (Il12rb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101702338 (Il12rb1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101702338 (Il12rb1)
   04659 Th17 cell differentiation
    101702338 (Il12rb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101702338 (Il12rb1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101702338 (Il12rb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101702338 (Il12rb1)
   04090 CD molecules [BR:hgl04090]
    101702338 (Il12rb1)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL6/12 receptor family
   101702338 (Il12rb1)
CD molecules [BR:hgl04090]
 Proteins
  101702338 (Il12rb1)
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N Interfer-bind
Other DBs
NCBI-GeneID: 101702338
NCBI-ProteinID: XP_012924112
LinkDB
Position
Un
AA seq 861 aa
MGRQVAWLCLLLLFLLSWQGGACRSGGCCFQDPSYPDTNPGSTSGPQDLSCYRVFNNAGH
YECSWSYNGPQVAVSHFLWCCFGNRSCCYFPAGPATRLQFSDQDGVPVLSNVTLWVESQA
ANRTEKSPAVTLRLHEWVRYDPPPRAARTSVSRGQLRMEWETPKNSVQLQFRRRKPGGSW
ELVSLFPGSKGHPSPQLHPTCGPPGLWGTRLRLGPFLVLNPLWLPDTQGSSGSSALRSQT
DGAGTQRGPRRGGREEAAAASPKVSLQGDCGPQDEPGSGSCRCPLEADAAQEFQFRWRRR
PGSGAPRGLWSAWSDPECAPPGSLPQPEATLEVAELGRDGRRRLRVQGQVRAAWGLAAGM
KPEAGRRGRGRGSARPYASCPPQPPQPQLPDGCRGTESGAQVTYFLRLRMRSCPCQAKPT
RTLRLEKRKIFLSGGAYDVAVLSRTRLGWGPNQTWLVPAVPAVPAAHTDPGALNVSTGAS
GFTVRWVAQAPGVTHCVEWQLFGPDAAPNCMVLSSQDPGPAGSGTVVTHSWSPALGVMGQ
DQCYHVTIFTSVRPEKATAWSTALSTYYFWGNASVAGTPPHVSVRNHSKDSAAVAWAPSP
MHGCPGVLATYAVRCVGDGGHEAEWLVAPSETQVTLQGLRPGTTYTVQVRADTAWLRGTW
SPPQRFSLAPQVSHVPVLSASLGSFVTILLLGALGYLGLSRAARHLWPPLPTPCASTAVV
FPSSQGKQPWPRLPARSACGAPRWTSRRRRPRQRRWWWRCAGSKARRRGQSRPGTPSWRC
WSPPGPPAPPGPRCSWGTLAGGAPRPETRGGPGGSGTGRPRPRRRCDPRLVSGRPPLCSP
RCPTSREGAGPARGSPKPASV
NT seq 2586 nt   +upstreamnt  +downstreamnt
atggggaggcaggtggcctggctgtgcctcctcctgctcttcttgctgtcctggcagggc
ggtgcctgcaggtctggtgggtgctgttttcaggacccgtcttatccggatacaaaccca
ggctccacctcgggcccccaggacttgagctgctaccgagtgttcaacaacgcaggtcac
tacgagtgctcctggagctacaacggcccccaggtggcggtcagccacttcctgtggtgc
tgctttggcaacaggtcctgctgctacttccccgcgggcccggccacccggctgcagttc
tccgaccaggacggggtgcctgtgctcagcaacgtcacgctctgggtggagtcccaggcc
gccaaccggacggagaagtcgcctgcggtcaccctacggctgcacgaatgggtgcgatac
gaccccccgccaagagcggccaggacgtccgtgtcccgcgggcagctgaggatggagtgg
gagacccccaagaacagcgtccagctgcagttccgccgccgcaagcccggcggttcgtgg
gagttggtgagtttgtttcctgggtcaaaggggcacccatctcctcagctgcaccccacg
tgcgggcccccaggtctctggggcacgcggctccgactgggacctttcctggtcttgaac
cctctgtggctccccgatacccaaggcagcagcgggtcctcagccttgcgctcccagacg
gacggggccgggacgcagcgcggccccaggagagggggaagggaagaagccgcggccgcg
tcaccgaaggtctctttgcagggcgactgcggcccgcaggacgagcccggctcagggtcc
tgccggtgccccctggaggcggacgcggcccaggagttccagttccggtggcggcggcgg
ccggggtctggggcccccagaggcctctggagcgcctggagcgaccccgagtgcgccccg
cccgggagcctcccgcagcccgaggcgactctggaggtggcggagctgggccgggacggg
cggcgtcggctgcgcgtgcaagggcaggtgcgggcggcctggggcctggcggcggggatg
aagccagaggccggaaggagaggacggggccgaggcagcgcgcgtccctacgcctcctgt
cccccgcagcccccgcagccccagctcccggacggctgtcgcgggaccgagtccggggcc
caggtcacctacttcctgaggctgcgcatgcggtcctgcccctgccaggccaagcccacg
cggaccctgcgcctggagaagcgcaagatcttcctctcaggcggcgcctacgacgtggct
gtcctctcgaggacccgcctgggctggggccccaaccagacgtggctcgtccctgccgtc
cccgccgtgcctgctgcccacacagaccccggggccctgaatgtcagcacaggggccagt
ggcttcacggtgcgctgggtggcgcaggccccgggtgtgacccactgcgtggagtggcag
ctgtttggcccagacgcggcccccaactgcatggtgctgtcatcgcaggacccgggccca
gcgggatcaggtacagtagtgactcatagctggagcccagctctgggggtgatggggcag
gaccagtgttaccacgtcaccatcttcacctctgtgcgcccagagaaggccacggcatgg
tccaccgcgctgtccacctactacttctggggcaacgcgtcggtggccgggaccccgcca
catgtgtcggtgcgaaaccacagcaaggactctgcggccgtggcctgggctccatcccca
atgcatggctgccccggtgtcctggcaacctatgctgtgcgttgtgtgggggacggcggc
cacgaggcagagtggctcgtggcacccagcgagacccaagtcaccctccagggcctgcga
cctggcaccacgtacacggtgcaggtgcgcgcggacacggcgtggctgcggggcacctgg
agtccgccccagcgcttcagcctcgcccctcaggtgtcccacgtacctgtcctgtccgcg
tccttgggcagctttgtgaccatcctcctgctgggcgccctggggtacctcggcctgagc
agggctgcgcggcacctgtggccgcccctacccacaccctgtgccagcactgccgtggtg
ttcccgagcagccaagggaagcagccttggccccgcctccctgcccgcagtgcctgtgga
gcaccccggtggacttcgcggaggaggcgtccccgccagagacgctggtggtggagatgt
gcggggtcgaaggcgaggcggcgaggccagagccgccccgggactcccagctggcggtgc
tggagcccgccggggccgcccgcgcccccagggccccgctgctcctgggggaccttggct
ggaggcgccccgcgcccggagacccgtggtgggcctgggggctcggggacggggcgcccg
cgtcctagaagacgatgcgatccccggctggttagtgggcgcccgccgctgtgcagcccg
cgttgccccacgtcccgcgagggggccgggccggccagggggtcccccaagcccgcctca
gtctga

KEGG   Heterocephalus glaber (naked mole rat): 101702638
Entry
101702638         CDS       T02812                                 

Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor receptor subunit alpha-like
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
hgl04640  Hematopoietic cell lineage
hgl05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101702638
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101702638
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101702638
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101702638
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101702638
   04090 CD molecules [BR:hgl04090]
    101702638
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL3 receptor family
   101702638
CD molecules [BR:hgl04090]
 Proteins
  101702638
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 101702638
NCBI-ProteinID: XP_004867364
LinkDB
Position
Un
AA seq 424 aa
MPGTLEATQGAAGPMPRGPRPAGSPGRFLPAALVLLLTLCLDPAAALAPELAEVEPAPRL
SVTFNPKSRRLTWDCRENATDARCFMLHKEKGPIEIKPWGKACACTFNYAPLHGGVTFEV
HATVRGRPVREELLYPNPGHEGTAARNFSCFIYDAGSLNCTWARGPAAPGDVQYFLFIEN
TKTQTEQECPLYSPDSGTHTGCHLRDLSALGFRNYFLLNGTSLAAPIQYFDSIWTAKEIE
RLSPPDNVTVYCNTSHCRIRWRPPQTWIPLTYKDFTYQLDIQRRHAGLGSGTPPVQVAGE
AENEYCFPSPEPRARQAVRVRVADVRGGPWSAWSRPAAFGSDTRAGPALRLYVPVVLGTL
VCALVLGFLFRRFVGLRALCPRVPQVKDKVSSVDGVAHQVPWEDFAPGIRKGELEDVLTV
EEVS
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgccggggacgctggaagccacgcagggagcagcaggcccgatgccgcgaggaccccgg
cccgcgggcagccctggccgcttcctccccgccgccctcgtcctcctgctgaccctgtgt
ctggaccccgccgcagccctggcccccgagctcgcggaggtggagccagccccgcgcctc
agcgtgacgttcaacccgaagtcgcggaggctgacttgggactgccgggaaaacgccacc
gacgccaggtgtttcatgcttcacaaggagaagggacccattgaaatcaagccctggggg
aaggcgtgcgcgtgcaccttcaactatgccccgctgcacggaggggtcaccttcgaggtc
catgccaccgtgcggggcaggcccgtccgggaggagctgctgtaccccaacccagggcac
gagggcacggccgcccgcaacttctcctgcttcatctacgacgccggctccctgaactgc
acgtgggcccggggtcccgcggcgcccggagacgtccagtacttcctgttcatcgagaac
accaagacgcagacggagcaggaatgtcccctgtacagtccggactcggggacccacacc
ggctgccacctgcgggacctgtcggccctgggcttccggaactacttcctgctgaacgga
accagcctggcggcccccatacaatactttgattccatttggaccgcaaaggaaatagag
cgactgagcccgccggacaatgtcaccgtgtactgcaacacatcacactgccgcatcaga
tggagacccccacagacctggatacctctgacctacaaggacttcacataccagctggac
atccagagacggcacgctgggcttggcagcgggacccctccggtccaggtggcgggcgag
gcggagaatgagtactgcttccccagccccgagccccgcgccaggcaggcggtgcgcgtc
cgggttgcagatgtgcgaggtgggccctggagcgcgtggagtcggccggcggcgttcggc
tctgacacccgggcgggcccggccctgcgcctctacgtcccggtggtgctgggcaccctc
gtatgcgccctggtcctcggcttcctcttcagaaggtttgttgggctccgtgctctgtgc
ccccgcgtgccacaggtcaaggataaagtgagcagcgtggatggagtcgcccaccaggtg
ccctgggaggacttcgcccccggcatcaggaaaggcgagctcgaggacgtgttgacggtg
gaggaagtgtcctga

KEGG   Heterocephalus glaber (naked mole rat): 101703833
Entry
101703833         CDS       T02812                                 

Gene name
Il6st
Definition
(RefSeq) interleukin 6 signal transducer
  KO
K05060  interleukin 6 signal transducer
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04061  Viral protein interaction with cytokine and cytokine receptor
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04630  JAK-STAT signaling pathway
hgl04659  Th17 cell differentiation
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101703833 (Il6st)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101703833 (Il6st)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101703833 (Il6st)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101703833 (Il6st)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101703833 (Il6st)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101703833 (Il6st)
   05203 Viral carcinogenesis
    101703833 (Il6st)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101703833 (Il6st)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101703833 (Il6st)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101703833 (Il6st)
   04090 CD molecules [BR:hgl04090]
    101703833 (Il6st)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL6/12 receptor family
   101703833 (Il6st)
CD molecules [BR:hgl04090]
 Proteins
  101703833 (Il6st)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind EpoR_lig-bind Pur_ac_phosph_N ObR_Ig Marek_A
Other DBs
NCBI-GeneID: 101703833
NCBI-ProteinID: XP_012928945
LinkDB
Position
Un
AA seq 906 aa
MLSLQIWLVQALVVFLTTESMGELVDTCGVISPESPVIRSGSNFTAFCVLKEKCMSIYEV
NASHIIWKANRVLIPEEQYTVINTTTSSVTFTNKSLSNVQLICNILAFGQIEMNVYGVKM
RVGFPPEKPKNLSCIVNEGKKMMCQWDPGRETHLETNFTLKSEWATEKFPDCKAKPDTPT
SCTVAFSPVYFVNVEVWVEAQNALGKVTSNHINFDPIDKVKPNPPHNLSVSNSEELSSIL
KLTWINPRIMNVIRLKYDIHYKTKDASAWSQIPSEDTATTRTSFTVQDLKPFTEYVFRIR
CMKEDGKGFWSDWSEDASGITYEARPSKAPSFWYKITSHTQGSRSVQLIWKPLPPFEANG
KILDYEVTLTRWKSRSQNYTVNDTDLTVNLTNDRYIATLAARNLVSKSDASILTIPAFDF
QATHPVTDLKAYPKDNMLWVEWTPPSKAVRKYIVEWCVLSDTSPCIPDWQQESSTIRRTY
LRGKLVESKCYLITVTPVYGDGPGSPESTKAYLKQAAPSKGPTVRTKKVGKNEAVLEWDQ
LPVDVQNGFIRNYTIFYKTSNGNETARISLKRAVNKIRMMLYYFFLCPWQQLFLITTSLL
AQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSKSHIAQWSPHTPPR
HNFNSKDQIYSDGTFTDVSVVEIEANDKKSFPEDLKSLDLFKKEKISTEGHSSGIGGSSC
MSSSRPSISSSDENESAQNTSSTVQYSTVVHSGYRHQVPSVQVFSRSESTQPLLDSEERP
EDLQLVDNVESGDGILPRQQYFKQNCSQPKTSPDISHFERSNPVSSGNEEDCLRLKQQQI
SDRISQSCGSEQMKMFQEVSATDAFGSETEGQVERFETVGIEATVDEGMPKSYLPQTVRQ
GGYMPQ
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgttgtcgctgcagatttggctcgtgcaagctctggttgttttcctcaccactgaaagt
atgggtgaacttgtggatacgtgcggtgttatcagccctgaatctccagttatccgaagt
ggttctaatttcactgcattctgtgtgttaaaggaaaaatgtatgagtatttatgaagta
aatgcttctcacattatctggaaagcaaaccgtgttcttattcctgaggagcagtatacc
gtcataaacacaacaacatccagtgtcacctttacaaataaaagtttatcaaatgttcaa
cttatatgcaacattcttgcattcggacagattgagatgaatgtctatggagtcaaaatg
cgagtaggctttcctccagaaaaacctaaaaatttaagttgcattgtgaatgaggggaag
aaaatgatgtgtcagtgggatcctggaagggaaacacacttggaaacaaacttcactttg
aaatctgagtgggcaacagagaagtttcctgattgtaaagcaaaacctgacacccccacc
tcatgcactgttgccttttctcccgtgtattttgtcaatgtggaagtctgggtagaagcg
cagaatgcccttgggaaggttacctccaatcatatcaactttgatcctatagataaagtg
aagcccaatccacctcataatttatcagtgagtaactcagaggagctatccagtatctta
aaattaacatggatcaatccaaggattatgaatgttataagactgaaatatgacattcat
tataagaccaaagatgcttcagcttggagccagattccttctgaagatacagcaacaacc
cgaacttcattcactgtccaggaccttaaaccttttacagaatatgtgtttaggattcgc
tgtatgaaggaggatggaaagggcttctggagtgactggagtgaagacgcaagtgggatc
acatatgaagcgagaccatccaaagcaccaagtttctggtataagataacatcccatact
caaggctctagatctgtacagctcatatggaagccactgcctccttttgaagctaatggg
aaaatcttggattatgaagtgactctaacaagatggaaatcacgttcacaaaattacaca
gttaatgacacagacttgacagtaaatctcacaaatgatcgctatatagctacactagca
gcaagaaatctggtcagcaaatcagatgcatctattttaactatccccgcctttgacttt
caagctactcaccctgtaacagaccttaaagcatatcccaaagataacatgctttgggta
gaatggactcctccaagtaaagctgtaaggaaatacattgttgagtggtgtgtgttgtca
gatacatcaccctgtatcccagactggcagcaggaaagcagtaccatccgtcgcacctat
ttaagagggaaactagtggaaagtaaatgttacttgataacagtcactccagtgtatggt
gacggaccaggaagccctgaatctacaaaggcataccttaaacaggctgcaccttccaaa
ggacctaccgttcggacaaaaaaagtgggcaaaaatgaagctgtcttagagtgggaccag
cttcctgttgatgttcagaatggatttatcagaaattataccatattttataaaaccagc
aatggaaatgaaaccgctaggattagtctgaaaagggctgtaaacaaaattagaatgatg
ttgtattatttctttctgtgtccatggcaacaattatttcttatcaccacctctctttta
gctcaaggagaaatagaagccatagttgtacctgtttgcttagcattcctgttgacaact
cttctaggtgtattgttctgctttaacaagcgagacctaattaaaaagcacatctggcct
aatgttccagacccttcaaagagtcatattgcccagtggtcacctcacacccctccaagg
cacaattttaattcaaaagatcaaatatattcagatggcacttttactgatgtgagtgtt
gtggaaatagaagcaaatgacaaaaagtcttttccagaagatctgaaatcattggaccta
ttcaagaaggaaaaaattagtaccgaaggacacagcagtggcattggggggtcttcatgc
atgtcatcttctaggccaagcatttctagcagtgatgaaaatgagtctgcgcaaaatact
tcaagcactgtccagtattctactgtggtacatagcggctacagacaccaggttccatca
gttcaagttttctcaagatccgaatctacccagcccttgttagattcagaggagcggcca
gaagatctacagttggtagataatgtagagagtggtgatggcattttaccccgtcaacag
tatttcaaacagaactgcagtcaacctaaaaccagtccagatatttcacattttgaaagg
tcaaatccagtttcatcaggcaatgaggaagattgtcttagacttaaacagcagcagatt
tcagatcggatttcacagtcctgtggatctgagcaaatgaaaatgtttcaggaagtttct
gcaacagatgcttttggctcagagactgagggacaggtagagagattcgaaacagttgga
atagaggccacagttgatgaaggaatgcctaaaagttacttaccacagactgtaagacaa
ggtggttatatgcctcagtga

KEGG   Heterocephalus glaber (naked mole rat): 101704138
Entry
101704138         CDS       T02812                                 

Gene name
Il4r
Definition
(RefSeq) interleukin 4 receptor
  KO
K05071  interleukin 4 receptor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04151  PI3K-Akt signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04640  Hematopoietic cell lineage
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl05200  Pathways in cancer
hgl05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101704138 (Il4r)
   04151 PI3K-Akt signaling pathway
    101704138 (Il4r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101704138 (Il4r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101704138 (Il4r)
   04658 Th1 and Th2 cell differentiation
    101704138 (Il4r)
   04659 Th17 cell differentiation
    101704138 (Il4r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101704138 (Il4r)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101704138 (Il4r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101704138 (Il4r)
   04090 CD molecules [BR:hgl04090]
    101704138 (Il4r)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL2 receptor family
   101704138 (Il4r)
CD molecules [BR:hgl04090]
 Proteins
  101704138 (Il4r)
SSDB
Motif
Pfam: IL4Ra_N fn3
Other DBs
NCBI-GeneID: 101704138
NCBI-ProteinID: XP_004856051
LinkDB
Position
Un
AA seq 718 aa
MGWLCSGLPFPVTCLALLWAAGCGSLKVLQKPTCFSDYLTLSTCEWRLDQALDCSAALHL
SYQLLSNPDPYEESHVCVPENSAATACVCDMGLRNLVVMDTYQLDLWAGKKLLWSYNFTP
SLHVKPRAPVNLTFSTNVSSGWLLSWSNLYPPWNYLHNKLTYQVNVSSKSEPERVKVYNV
TYKETTFHLEARDLTSGISYTARVRALAQLGGSIWSEWSPGATWENYYEQPLEQRLKLGV
VIACFLVVLICLSCYCSVTRIKREWWDQIPNPACSPVVAIVLQDPQVSPWEKWPRGQQPG
KRPHWKTCLTKLLPCLLEHGMKKDKDLLKVARNRPLHGPRKSTWCPMEISKTVLLPETIS
VVRCVELFEAPGKAEEEEEEEEEGEGTKYFCTSEESSEGEGSFGEGREGIAARLTERLLL
GLLGAEEGAARAPTPPVPSAARAPACTAEALLVEDNPAYRSVGPLLGWAQSPGEPAPDAP
RAASLGEGDPEGPGGAPPTEPPSWEQLLRLRVLQHGAAPAGPCAGYRAFAQAAEPEAGYT
ASPGPHPDGAACSGLTGAGASSGAGGYRPFQDLAAGPLFPLGLDVEPPRSPAAGLGPGVT
EDEQKPPRPPQQAAEPVGDDLGSGGVYSALTCHLCGHLKQCHGQEEPGQAQVAPGPGCGC
CCGDRALPPGPPPAQRSPAGPSVSKEAKTAAPSGAHSSSQAWKGPGLGPPGRPSARVS
NT seq 2157 nt   +upstreamnt  +downstreamnt
atggggtggctctgctctggcctgccattccctgtgacctgcctggcgctgctgtgggcg
gccggctgtgggagcctgaaggtcctgcagaagcccacctgcttctcagactacctcacc
ctctccacctgcgaatggcggctggaccaggccctggactgcagcgcagcgctccaccta
tcctaccagctcctgtccaacccagacccctatgaagaaagccacgtctgtgtccccgag
aacagtgccgccacggcatgtgtgtgtgacatgggcctgagaaacctggtcgtcatggac
acctaccagctggacctgtgggccgggaagaagctgctgtggagctacaacttcacgccc
agcctgcacgtgaagcccagagccccggtgaacctcacgttcagcaccaacgtctccagc
gggtggctgctgtcgtggagcaacctgtacccgccctggaactacctgcacaacaagctc
acctaccaggtcaacgtttccagcaagagcgagccggagcgcgtcaaagtttacaatgtg
acctacaaggagaccaccttccacctcgaagcccgagacctgacgtctgggatctcctac
acggcgcgcgtgcgggccctggcgcagctggggggcagcatctggagcgagtggagcccc
ggggccacgtgggagaactactacgagcagcccctggagcagcggctcaagctgggcgtg
gtcatcgcctgcttcctggtggtgctcatctgcctgtcctgctactgcagcgtcaccagg
attaagagagagtggtgggaccagatccccaacccagcctgcagccccgtggtggccatt
gtccttcaggacccccaggtgtcaccatgggagaagtggccgcggggccaacagcccggg
aaacgcccacactggaagacatgtctgaccaagctcctcccctgtttgctggagcatggc
atgaaaaaggataaagacctcctgaaggtggccagaaacaggcctttgcatggccccagg
aagtcaacatggtgccctatggagatcagcaagacagtcctcctgccagagaccatcagt
gtggtgcggtgtgttgagctgtttgaggccccgggaaaggctgaggaagaggaggaggag
gaggaggagggagagggtacaaagtacttctgcacgtcagaggagagcagcgagggcgag
ggcagttttggagagggcagggagggcatcgcagcacggcttaccgagcgcctgctcctg
ggcctgctgggcgccgaggagggggccgcccgcgccccgacgccccctgtgcccagtgcg
gcccgggcccccgcctgcaccgcggaggcgctgctggtggaagacaaccccgcctaccgc
agcgtgggccccctcctgggctgggcccagagccccggagagccagccccggatgccccg
cgggccgcgagcctgggggaaggggaccccgagggccctggtggcgccccgcccacagag
ccgcccagctgggagcagctcctgcgcctgcgtgtccttcagcacggggccgcccctgct
ggcccctgcgccggctaccgggcgttcgcgcaggcggccgagcctgaggctggatacacg
gcctcccccggcccacaccccgacggggccgcctgctcggggctgacaggggccggggcc
agcagcggggcagggggctacagacccttccaggacctcgcggccgggcccctcttcccc
cttggcctggacgtggagccgcctcgcagccccgcagctggcctgggcccgggggtcacg
gaggacgagcagaagcccccgcggcccccacagcaggccgcagagcccgtcggggacgac
ctgggcagcggcggcgtctactctgccctcacctgccacctgtgtggccacctgaagcag
tgccacggccaggaggagcccggccaggcccaagtcgcgcccgggcccggctgcggctgc
tgctgtggggacagggccttgcccccagggccgccccctgcccagcgcagccccgcgggc
ccctccgtctccaaggaggccaagactgctgcccccagcggcgctcacagctccagccag
gcctggaaagggccgggcctgggacccccggggcgcccgagcgcgagggtttcctag

KEGG   Heterocephalus glaber (naked mole rat): 101704145
Entry
101704145         CDS       T02812                                 

Gene name
Cntfr
Definition
(RefSeq) ciliary neurotrophic factor receptor
  KO
K05059  ciliary neurotrophic factor receptor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101704145 (Cntfr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101704145 (Cntfr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101704145 (Cntfr)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hgl00537]
    101704145 (Cntfr)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL6/12 receptor family
   101704145 (Cntfr)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hgl00537]
 Receptors
  101704145 (Cntfr)
SSDB
Motif
Pfam: fn3 Ig_3 Ig_5
Other DBs
NCBI-GeneID: 101704145
NCBI-ProteinID: XP_004838484
LinkDB
Position
Un
AA seq 392 aa
MAEMEGEGLRATSKAEVGNQMAAPVPWACCAVLAAAAAVVYTQRHSPQEAPHVQYERLGS
DVTLPCGTANWDAAVTWRVNGTDLASDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQ
VLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPAL
KNRCHIRYMHLFSTIKYKVSISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPR
RLEVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQV
AAKDNEIGTWSDWSVAAHATPWTEEPRHLTTEAQAPETTTSTTSSLAPLPTTKICDTGEL
GSGGGPSIPFLISVPVTLALAAAATTTSSLLI
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggcagagatggagggggaaggtctgagggccaccagcaaggctgaggtggggaatcag
atggctgctcctgtcccatgggcctgctgtgctgtgcttgctgctgctgccgcagttgtc
tacacccagagacacagtccacaggaggcaccccatgtgcagtatgagcgcctgggctca
gatgtgacgctgccatgtgggacagcaaactgggatgcagctgtgacgtggcgagtaaat
gggacagacctggcctctgaccttctcaatggctctcagctggtgctccatggcctggaa
ctgggccacagtggcctctacgcctgcttccaccgtgactcctggcacctgcgccaccaa
gtcctgctacatgtgggcttgccgccgcgggagcccgtgctcagctgccgctccaacact
taccccaagggcttctactgcagctggcatctgcccacccccacctacatccccaacacc
ttcaatgtgactgtgctgcacggctccaaaattatggtctgtgagaaggacccagccctc
aagaaccgctgccacatccgctacatgcacctgttctccaccatcaagtacaaggtctcg
atcagtgtcagcaatgccctgggtcacaacgccacagctatcaccttcgacgagttcacc
attgtgaagcctgaccctccagaaaatgtagtagctcggccagtgcccagcaaccctcgc
cggctggaggtgacatggcagactccttcaacttggcctgaccctgagtcctttcctctc
aagttctttctgcgctaccggcccctcattttggaccagtggcagcatgtggagctgtcg
gatggcaccgcacacaccatcacggatgcctatgctgggaaggagtacatcatccaggtg
gcagctaaggacaatgagatcgggacatggagtgactggagcgtggccgcccatgccacg
ccctggactgaggagcctcgacacctcaccactgaggcccaggccccggagaccacgacc
agcaccaccagctcactggcacccctgcccaccacgaagatctgtgacaccggggagcta
ggcagcggcggagggccctccatacccttcttgattagtgtccctgtcactctggccctg
gctgctgctgccaccacaaccagcagcctcctgatctga

KEGG   Heterocephalus glaber (naked mole rat): 101704925
Entry
101704925         CDS       T02812                                 

Gene name
Il6r
Definition
(RefSeq) interleukin 6 receptor
  KO
K05055  interleukin 6 receptor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl04060  Cytokine-cytokine receptor interaction
hgl04061  Viral protein interaction with cytokine and cytokine receptor
hgl04066  HIF-1 signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04640  Hematopoietic cell lineage
hgl04659  Th17 cell differentiation
hgl04932  Non-alcoholic fatty liver disease
hgl05163  Human cytomegalovirus infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101704925 (Il6r)
   04066 HIF-1 signaling pathway
    101704925 (Il6r)
   04151 PI3K-Akt signaling pathway
    101704925 (Il6r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101704925 (Il6r)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101704925 (Il6r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101704925 (Il6r)
   04659 Th17 cell differentiation
    101704925 (Il6r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101704925 (Il6r)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101704925 (Il6r)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101704925 (Il6r)
   05163 Human cytomegalovirus infection
    101704925 (Il6r)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101704925 (Il6r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101704925 (Il6r)
   04090 CD molecules [BR:hgl04090]
    101704925 (Il6r)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL6/12 receptor family
   101704925 (Il6r)
CD molecules [BR:hgl04090]
 Proteins
  101704925 (Il6r)
SSDB
Motif
Pfam: IL6Ra-bind Ig_3 Ig_2 fn3 ig I-set
Other DBs
NCBI-GeneID: 101704925
NCBI-ProteinID: XP_012923406
LinkDB
Position
Un
AA seq 437 aa
MLAAACALLAALLAVPGQARVCSAPALMRREVQTSLPGANVSLPCPAADLREDNSVYWVV
SDAHARLAGVGRRLLLTSVQPSDSGNYSCYADGRLAGTVRLLVEAPPEQPQLSCWRRSLL
GSVVCEWSPRNAPSLTTKAELWVRKLQTHPMEESQEPCLYSRESRKFFCQFPVPEGDTSI
RMVSVCVANSAGSSVSSKETVQVHKILKPDPPVGVTVAAVAGHPRWLNVTWKDPSSWDSD
FYRLHFELRYRAEQSGAFTSWRIQTQDPTHQCIIPDALRGHWHVVQLRAREEFGIGSWSE
WSPEARGAPWTAPRASPATPHSTKVLTTDEEDPGSPLATSLPVQVSFPAPLPAFLVAGGS
LAFGSLLCIGLVLRFKRTWRARAVQECKQSVPPKPTLALAPLLSSLGSDNTSSQSRPDAR
DPRGPFDVSNRDYFFPR
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgctggccgccgcctgcgcgctgctggccgcgctgctggccgtgccggggcaggcgcgg
gtctgctcggcgccagccctgatgcgaagagaggtccagaccagcctgccgggggccaac
gtctccctgccctgccctgcggcggacctgagggaagacaactctgtctactgggtggtc
tccgacgcgcacgcgaggctggccggcgtgggacgcaggctgctgctgacgtcggtacag
cccagtgactctggcaactactcgtgctacgcggacggacgcctggccgggacggtgcgt
ctgctggtggaagcccccccggagcagccgcagctctcctgctggcgcaggagcctcctg
ggcagtgttgtctgcgagtggagccctcggaatgccccatccctgacgaccaaggcggag
ctgtgggtgaggaagctccagacccaccccatggaggagtcccaggagccgtgcctgtac
tcccgggagtcccggaagttcttctgccagtttccagttccggagggggacacctctatc
cgtatggtgtcggtgtgcgtggccaacagtgcagggagcagcgtcagcagcaaggagacg
gtgcaggtccacaagatcttgaagcccgacccgcctgtcggcgtcaccgtcgccgctgtg
gccggacatccccggtggctcaacgtcacctggaaggaccccagctcctgggactcagac
ttctaccggctgcactttgagctccgataccgggccgagcagtccggggccttcacaagc
tggaggatccagacccaggaccccacgcaccagtgcatcatccccgacgccctgcgtggc
cactggcacgtagtgcagctccgggcccgggaggagttcgggatcggctcctggagcgag
tggagccccgaggccagaggggccccctggacagcacccagggcttccccagctacgccc
cacagcacgaaggtgctgactactgatgaagaggacccaggttccccattagcaaccagc
ctcccagtgcaagtttccttccccgcaccgctccccgcattcctggtggctggagggagc
ctggcctttgggtctctcctctgcatcggcctcgtcctaaggttcaagaggacgtggaga
gcgcgggccgtccaggagtgcaaacagagcgtgccccccaagcccaccctggcgcttgct
cctctgctcagcagcctcgggtctgacaacacctcgagccaaagccggccagatgccagg
gacccacgaggccctttcgacgtcagcaacagagactacttcttccccagatag

KEGG   Heterocephalus glaber (naked mole rat): 101705981
Entry
101705981         CDS       T02812                                 

Gene name
Lepr
Definition
(RefSeq) leptin receptor
  KO
K05062  leptin receptor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04080  Neuroactive ligand-receptor interaction
hgl04152  AMPK signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04920  Adipocytokine signaling pathway
hgl04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101705981 (Lepr)
   04152 AMPK signaling pathway
    101705981 (Lepr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101705981 (Lepr)
   04060 Cytokine-cytokine receptor interaction
    101705981 (Lepr)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101705981 (Lepr)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101705981 (Lepr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101705981 (Lepr)
   04090 CD molecules [BR:hgl04090]
    101705981 (Lepr)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  Prolactin receptor family
   101705981 (Lepr)
CD molecules [BR:hgl04090]
 Proteins
  101705981 (Lepr)
SSDB
Motif
Pfam: ObR_Ig Lep_receptor_Ig fn3 SRTM1
Other DBs
NCBI-GeneID: 101705981
NCBI-ProteinID: XP_004841567
LinkDB
Position
Un
AA seq 1162 aa
MIFQTFSVALLHCEFLHVITAFNLAYPVTPWRFKLSCLPSNNTDDYSLLPAGMPNNTSYL
SGSHESVVEARFNSSGADMADLSPATFHCCFWSEQDKNCPVRVEGETSVSTVDSSVFQQR
GANWNIQCWMKGDLKLFMCSVEPLLKSSLKNYGLKAHLFYVPSEVVEDLHLAPQKGRFES
VQCNCSFEEPCGCQMPVPVAKRNDTFLMYLRITAAGVTFQSPLMSVQPLNVVKPDPPLDL
HMEITEDGNLNISWFSPTLVPFPLQYQVKYSENSTTLTREAEETVSVTALLVDSVLPGST
YEAQVRGRRLDGPGAWSDWSTPRGFTTQDVIYFPPKILTSAGSNVSFHCIYKNENTIVSS
QEIVWWVNLAEEIPPSQYDVVSDHVSKVTFLDLRATRPRDEFTYDAVYCCQQHQCHRRYA
ELYVIDVNINISCETDGYLTKMTCRWPANPMQSLVGSSWQLRYYRSSLYCSDSPSISPVS
EPKDCHLQRDGFYECIFKPIFLLSGYTMWIRITHSLGSLDSPPMCVLPDSVVKPLPPSSV
KAEITANIGLLKISWEKPVFPENKLQFQIRYGLRGKEIQWKTHEVDDAKSRSASVPVRDP
CAVHAVQVRCRRLDGLGYWSNWSSPAHTAVTDVRVPVRGPEFWRRINGDITNRERNITLL
WKPLMKNDSLCSVRRYVVKHWTSHNATWSEDAGNQTQLTFLWTEQAHTVTILAINSLGAS
LANLNLTFSWPMSEVNILQSLGAYPLNSSCVILSWVLSPSDYNLMYFIIEWKNLDEDDEI
KWLRIPSNVKKYYIYDYFIPIEKYQFSLYPVFSEGVGKPKIINGFTKVDEKHQNDAGLYV
IVPIIISSSVLLLGTLLISHQRMKKLFWDDVPNPKNCSWAQGLNFQKPETFEHLFTKHTG
SVTFVPLLVEPETISEDLSIDMPWKHAEDTAPAALVSLLLTAPDPEKGSVCTSDRCDSPL
FSDRGNSEVSWEHDSPGPPSVKYATLVSSSKSGEAGERQGLLHTSVSKGFSGKSSPLRDS
FSNSSWEIETQAIFILSDQQSDMISPHLSFSEGLDELLELEGNFPEENQSEKSIYYLGVT
SIKERESGVFLTEESRVLCPFPPHCLFADISILQDSCSHLVENNFNLGTSGKKTFVSYVP
QFQTCSTQTHKIVENKMCDLTV
NT seq 3489 nt   +upstreamnt  +downstreamnt
atgatttttcaaacattctctgtggctttgttacactgtgaatttcttcatgtgataacc
gcatttaacttggcatatccagtcactccctggagatttaaactgtcttgcctgccatca
aataacactgatgactactccctcttgcctgctggaatgccaaacaacacttcgtatttg
agtggaagtcatgagtcagtggttgaagccagatttaattcaagtggtgccgacatggct
gatttatccccagcaactttccactgttgcttttggagtgagcaagataaaaactgccct
gtgcgtgtggaaggggagacctctgtctctacagtggattcttctgtttttcaacagcgg
ggtgcaaactggaacatacagtgctggatgaaaggggacttgaaattatttatgtgttct
gtggagcccttacttaagagttctctcaagaattacggcctcaaagctcatcttttctat
gtcccgtctgaagtggtagaagatttgcacctggccccccagaaaggccgcttcgagagc
gtccagtgcaactgcagctttgaggaaccctgtgggtgtcaaatgccagtaccagtagcc
aagcgcaatgatacctttctgatgtatttgagaatcacagctgctggggtaacttttcag
tcacctctaatgtcagttcagcccttaaatgttgtgaagcctgatccaccattggatttg
catatggaaatcacagaggatggcaatttaaatatttcttggttcagcccaacactggta
ccatttccacttcagtatcaagtgaaatattcagagaattctaccacactcacgagagaa
gcggaggagacggtctctgtgacagccctcctggtggacagcgtgcttccgggctccacc
tacgaggctcaggtgaggggccggagactggacggcccgggggcctggagtgactggagc
acccctcgaggctttacaacgcaagatgtcatatactttccacctaaaattctcacaagc
gctgggtctaacgtttcctttcactgtatctataaaaatgaaaacacgattgtttcctca
caagagatcgtttggtgggtgaatttagctgaggaaattcctccaagccagtacgatgtg
gtgagtgaccatgttagcaaagtgactttcctggacctgagagcgaccagacctcgggac
gagttcacctacgatgccgtgtactgttgccaacagcaccagtgccaccgtcgctacgcc
gagttgtatgtgattgatgtcaatatcaatatatcatgtgaaactgatgggtacttaact
aaaatgacttgcagatggccagccaacccaatgcaatccctcgtggggagctcctggcag
ttgagatattacaggagcagcctgtattgttctgatagtccatctatctctccagtatcg
gaaccgaaagattgtcatttgcagcgggatggcttttatgaatgcattttcaagcccata
tttctgttatctggctacacaatgtggattcggatcactcactctttaggttccctggac
tctccaccgatgtgtgtgctcccggactctgtagtgaaaccactgcctccatccagtgtt
aaagcagaaattactgcaaatattggattattgaaaatatcttgggaaaagccagtcttt
ccagagaataagcttcagttccagattcgctatggcttacgtggaaaggaaatacaatgg
aagacgcacgaggtggatgacgcaaagtcgaggtctgccagtgtccccgtgcgagatccg
tgcgcagtgcacgctgtgcaggtgcgctgcaggaggctggacgggctgggttactggagc
aactggagcagcccagcgcacactgcggtcacggacgtcagagttcccgtgagaggacct
gagttttggagaagaattaatggagatattactaacagagagcgaaatatcaccttgctt
tggaagcccctgatgaaaaacgactctctgtgcagcgtgaggagatacgtggtgaagcac
tggacttcccacaacgcaacatggtcagaggatgcggggaaccagacccagctcactttc
ctgtggacggagcaggcgcacaccgtgacgattctggccatcaattcccttggggcttcc
cttgccaatttgaacctcacgttctcatggcccatgagcgaagtaaatatcctgcagtca
cttggtgcttaccctttaaatagcagttgtgtgattctttcctgggttctatcacccagt
gattacaatctgatgtattttattattgaatggaagaatcttgatgaagatgatgaaatt
aaatggcttagaatcccttcaaatgttaagaagtattatatctacgattattttatcccc
attgaaaagtatcagttcagtctgtacccagtattttcagaaggagtggggaaaccaaag
ataattaatggcttcaccaaagttgatgaaaaacaccagaatgatgcaggtctatatgtc
attgtgccgataattatttcctcttctgtcttattgctgggaacactgttaatatcacac
caaagaatgaaaaagctgttttgggatgatgttccaaaccccaagaattgttcctgggca
caaggacttaactttcagaagcccgaaacatttgagcatctttttaccaagcacacagga
tcagtcacctttgttcctcttcttgtggagcctgaaaccatttcagaagacctcagtatc
gatatgccgtggaaacatgcagaagacacggcgccagcagctctggtctcactgcttttg
acggctcctgatccggagaagggctctgtctgcacgagtgaccggtgtgacagccctctc
ttctcggacagggggaactctgaggtgagttgggagcacgacagcccggggccgccctcg
gtcaagtacgccacgctggtcagcagctccaagtcaggtgaagccggtgagcggcaagga
cttctacacacttccgtcagcaagggcttctctggcaagagttctccactgagagattct
ttctcgaatagctcgtgggagatagaaactcaagcaatttttatattatcagatcagcag
tctgacatgatttcaccacacctttcgttctcagaaggattggatgaacttttggagctg
gagggaaatttccctgaagaaaaccagagtgaaaagtctatctattatttaggggtcacc
tcaatcaaggagagagagagtggtgtgtttttgactgaggagtccagagtactgtgccct
tttccgccccactgtttatttgctgacattagcatactccaggacagttgctcacacttg
gtggaaaataatttcaacttaggaacttctggcaagaagacttttgtgtcttacgtgccc
cagtttcaaacctgttctacgcagacccataagatagtggaaaacaagatgtgtgacctg
actgtgtga

KEGG   Heterocephalus glaber (naked mole rat): 101706532
Entry
101706532         CDS       T02812                                 

Gene name
Il10ra
Definition
(RefSeq) interleukin 10 receptor subunit alpha
  KO
K05134  interleukin 10 receptor alpha
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04061  Viral protein interaction with cytokine and cytokine receptor
hgl04630  JAK-STAT signaling pathway
hgl05145  Toxoplasmosis
hgl05152  Tuberculosis
hgl05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101706532 (Il10ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101706532 (Il10ra)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101706532 (Il10ra)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101706532 (Il10ra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101706532 (Il10ra)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101706532 (Il10ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101706532 (Il10ra)
   04090 CD molecules [BR:hgl04090]
    101706532 (Il10ra)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL10/28 receptor family
   101706532 (Il10ra)
CD molecules [BR:hgl04090]
 Proteins
  101706532 (Il10ra)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind AGTRAP
Other DBs
NCBI-GeneID: 101706532
NCBI-ProteinID: XP_004856739
UniProt: G5BHK6
LinkDB
Position
Un
AA seq 589 aa
MLPHLLVPLAALLSLRLGPGTHGSELPKPPEAWFEAEFFHHILCWLPISNQSKSTYYEVQ
LAWYGRSPWESLPNCGQALELCCDVTMYTLHLYRSNGYRAKVRTVDGSRYSNWTFANTRL
SVDDVTLKVDSVKLEMHEGFIFGMIQLPRPQVAPPGDTYESIFTNFRQYEIAIRKVPGSF
KSSRMVDHENFTFPIPGEVGKFCVKVKPSISSRTNKGIWSEEQCITLTKQYFTVTNLSIF
FTLILLLCGPLAYCLVLHLYVRRRGTLPAVLVFEKPSPSILISKPPYPEMQDAIQPLHEE
TFLKVSPELRHSDLHGSMNIGFSSAKPSLQMEEPQFLLPAPHTQACGALGKGEPPDLQVS
CSDGGSSGSGSSGSCSSSTDSGICLQEPGLNPGSGPLWEQKVGSTSQGQDDSGISLVQNS
EGQPGRTQNSSPLGHISLLGPEAPAEEDPATAAFQGYLKQTRCTEEKTTIAACLEEETPL
TDGLWPQFRTCLDPEAGWPPPGLAKGYLKQDPPEITLAPSGVPPGQCNQMTEEWPLLGLT
ICGDLGPSDWSFTHDLAPQDGVAAPGGLLGSFDSDLVTQPQISSLYSSE
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgctgccgcacctgctagtgcctctggcggcgctcctcagcctgcgcctcggccccggc
acgcacggctcagaactacccaagcctccagaggcgtggtttgaagcagaatttttccac
cacatcctctgctggctgcccatctcaaatcagtccaaaagcacctactatgaggttcag
cttgcctggtatggaagaagtccatgggagtcccttcctaactgtggccaggccttggaa
ctgtgctgtgatgtcaccatgtacaccctgcacctgtaccgaagcaatggttaccgggct
aaagtccggacagtggatggtagccgatactccaactggacctttgccaacacccgcttg
tctgtggatgacgtgactctgaaggttgatagtgtgaagctagagatgcatgagggcttc
atcttcggaatgatccagctccccaggccccaggtggcccctccaggtgacacatacgaa
agcatctttacaaacttccgccagtatgagattgccattcgcaaagtgccaggaagcttt
aagtcaagccggatggtagaccatgaaaacttcaccttcccaatccctggagaggtggga
aagttctgtgtcaaagtgaagccgtctatcagctcccgaaccaacaaggggatctggtca
gaggagcagtgcatcaccctcaccaagcagtatttcaccgtgaccaaccttagtatcttc
ttcaccctcatcttgctgctctgtggacccctggcttactgtctggtcctccacttgtat
gtgcggcgccgagggacactgcctgctgtcctggtctttgagaaacccagcccttccatc
ctcatcagcaagccgccctacccagagatgcaggacgccattcaacccctccacgaggag
accttcctgaaggtttctccagagctgaggcactcagacctgcatggcagcatgaacatt
ggcttcagcagtgccaagccatccctgcagatggaagagccccaattcctcctccctgcc
cctcacacccaggcctgtggggctctaggaaagggggagcccccagatctgcaggtcagc
tgcagtgatggtggcagcagtggcagcggcagcagtggcagctgcagcagtagcacagac
agcgggatctgcttgcaggagcctggcctgaaccctggctctggacccctttgggagcag
aaggtggggagcacaagccagggccaggatgacagtggcattagccttgtccaaaactct
gaggggcaacctgggagaacacagaacagctcacccttgggccacataagtctcctaggg
ccagaggcccctgcagaagaagacccagctacagcggccttccagggctacctgaaacag
accagatgcactgaagagaaaacaaccatagcagcctgcctggaggaagagactcctttg
acagatggcctttggccccagttcaggacatgcctggatcctgaggcaggctggcctccc
ccaggtctggccaagggctacttaaaacaagatcccccagaaataaccctggctccttca
ggtgtcccaccaggacaatgtaatcagatgactgaggagtggccactgctgggcttgact
atttgtggtgacctgggaccatctgattggagttttacccatgatcttgcccctcaggat
ggtgtggcagccccaggaggcctcttgggcagctttgactcagacctggtcacccagcct
cagatctccagcctgtactcaagtgagtga

KEGG   Heterocephalus glaber (naked mole rat): 101707597
Entry
101707597         CDS       T02812                                 

Gene name
Mpl
Definition
(RefSeq) MPL proto-oncogene, thrombopoietin receptor
  KO
K05082  thrombopoietin receptor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101707597 (Mpl)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101707597 (Mpl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101707597 (Mpl)
   04090 CD molecules [BR:hgl04090]
    101707597 (Mpl)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  Prolactin receptor family
   101707597 (Mpl)
CD molecules [BR:hgl04090]
 Proteins
  101707597 (Mpl)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Other DBs
NCBI-GeneID: 101707597
NCBI-ProteinID: XP_004871918
UniProt: G5AQG2
LinkDB
Position
Un
AA seq 635 aa
MPSWALFVVTSCLLLAPQNLAQVTSQDVSLLASDSKPLNCFSQTFEDLTCFWDEEEAAPS
GTYQLLYAYSGEKPRACPLSSQSVPRYGTRYMCQFPGQDEVRLFSELHLWVKNVFLNQTL
TEWVLSVDTVGLPAPPSIIKAASGSQPGELQILWEAPAPEISDFLRHELRYGPVDPRNAT
GARVMQLLPTETCCPTLRRPNPVSALDQPPCVQPTAPQRDGPRHTSPTGEAPSLPVMGGS
CLISGLQAGNSYWLQLRSQPDGISFSGSWGSWSLPVTVDLPGDAVAIGLQCFTLDLKNVT
CQWQQQNHTRSQGFFYHNKAQCCPRHREPIWEKCEEDKKTNPGLQLPQLSRCHFKSENDS
VIHTLVEVTTAHGVIHSYLGSPFWMHQAVLIPTPNLHWREVSSGQLALEWQQPSSWAAQD
TCYQLRYMGEGHRDWKVLEPPLGAQGGSLELRPRSRYRLQLRARLNGPTYQGPWSAWSET
EWVETASEPAWISLVTVLLLVLGLSALLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLG
QYLRDTAALSIPKATITDTYEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRGLQPSCLG
AMPLSVCPSMAESGSCCTTHIANHSYLPLSCWQQP
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgccctcctgggccctctttgtggtcacctcctgcctcctcctggccccccaaaacctg
gcacaagtcaccagccaagatgtctccttgctggcctcggactcaaagcccctcaactgt
ttctcccaaacattcgaggacctcacttgcttctgggatgaggaagaggcagcacccagt
gggacatatcagctgctatatgcctactcaggagagaagccccgtgcctgccccctgagt
tcccagagtgtgccccgctatggaacccgatacatgtgccagtttccaggccaggatgaa
gtacgcctcttctctgagctgcacctctgggtgaagaatgtgttcctgaaccagactctg
actgagtgggtgctgtctgtggatactgtgggtctgccagctccccccagtatcatcaag
gctgcaagcgggagccagccaggggaacttcagatcctctgggaggctccagctcctgaa
atcagtgatttcctgaggcacgaactccgttatggccctgtggaccccaggaacgccact
ggggcccgagtcatgcagctgctccccacagagacctgctgccctactctgcggaggcca
aacccagtctctgctctggaccagcctccgtgtgttcaacccacagcaccccaacgggat
ggaccaaggcacacttccccaactggagaagctccctctctgcctgtgatgggtggaagc
tgcctcatttctgggctccaggctggcaattcttactggctccagctgcgcagccagcca
gatggaatctctttcagtggctcctggggatcctggtcccttcctgtgaccgtggacctg
cctggggatgcagtggcaattggattgcaatgttttaccttggacttgaagaatgttacc
tgtcagtggcagcaacagaaccatactcgctcccagggcttcttctaccacaacaaggcc
cagtgctgccccagacacagggagcccatctgggagaagtgtgaagaggacaagaaaaca
aatccaggattacagctccctcagctctcccgctgccacttcaagtcagagaatgacagt
gttattcacacccttgtagaagtgaccacagcccacggtgttattcacagctacctgggc
tcccctttctggatgcaccaggccgtgctcatccccaccccaaacctgcactggagggag
gtctccagtgggcagctggcattggagtggcagcaaccatcatcctgggcagcccaagat
acctgctatcagctccggtacatgggagaaggccatcgggactggaaggtgctggaaccg
cctctcggggcccagggagggagcctggagctgcgcccgcgatctcgctaccgtttacag
ctgcgcgccaggctcaacggccccacctaccaaggcccctggagcgcttggtctgagacc
gagtgggtggagacagcttcggagccggcctggatctccttggtgaccgttctgctactg
gtgctgggcctcagcgcccttcttggcctgctgctgctgaggtggcagtttcctgcgcac
tacaggagactgaggcacgctctgtggccctcacttccagacctgcaccgggtcctaggc
cagtaccttagagacactgcagccctgagtattcccaaggccacaatcacagatacctat
gaagaagtggaacccagcctgctcgagatcctacctaaatcctcagagaggacccccttg
cccctatgttcctcccaggcccagatggactaccgaggattgcagccttcctgcctgggg
gccatgcccctgtctgtgtgcccatccatggctgagtcagggtcctgctgtactacacac
attgccaaccattcctacctaccattaagttgttggcagcaaccctga

KEGG   Heterocephalus glaber (naked mole rat): 101708949
Entry
101708949         CDS       T02812                                 

Gene name
Il11ra
Definition
(RefSeq) interleukin 11 receptor subunit alpha
  KO
K05056  interleukin 11 receptor alpha
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
hgl04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101708949 (Il11ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101708949 (Il11ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101708949 (Il11ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101708949 (Il11ra)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL6/12 receptor family
   101708949 (Il11ra)
SSDB
Motif
Pfam: Ig_3 ig
Other DBs
NCBI-GeneID: 101708949
NCBI-ProteinID: XP_012925242
LinkDB
Position
Un
AA seq 420 aa
MSSSCSGLSRVLVAIAIALVSASSSCPQGWGPPGVQYGQPGRLVMLCCPGVSAGTPVNWF
RDRESRLLQGPDSGLGHKLVLARADSTDEGTYICRTLDDEVEGTVTLKLGYPPSRPVVSC
QASDYENISCTWSPSQVSGLPTCYLTSYRMKMLPGTGHQRVNLSAWKPCPQDPLGNPRCV
IYWAEFWSQYRINVTEVNPLGASTRLLDVSFWDILRPDPPEGLRVESVPGYPRRLHASWM
YPTSWPQKPHFTLKFRLQYRPAQHPAWSTVEPIDLEEVITDAVAGLPHEVRVSARDFLDA
GTWSTWSPVVLGTPSTESLTNEIPDPGKIYTQLVDSMAPPRPSLQPDPRPLNHRDPLEQM
VVLVSLGVFSFLGLAAGALTLGFCCLFRLRLRWSRKDGPQKPGFLASMIPADKLPGIPDL
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgagcagcagctgttcagggctgagcagggtcctagtggccatagctatagccctggtt
tctgcttcttcttcctgcccccagggctggggccccccaggggtccagtatgggcagcct
ggcaggctggtgatgctgtgttgcccaggagtgagcgctgggacccctgtgaactggttt
cgggacagggagtcaaggctgctccagggacctgactctgggctgggacataaactggtc
ctggcccgggcagactctactgatgagggcacctacatctgccggaccctggatgatgaa
gttgaaggcacagtgaccctaaagctgggctatcccccatcccgtccagtggtctcctgc
caagcatctgattatgagaacatctcctgcacttggagccccagccaagtcagtggttta
cccacctgctacctcacctcctacaggatgaagatgttgccaggaactggtcaccagagg
gtgaatctatctgcatggaagccatgcccacaggaccccttagggaatccacgctgtgtt
atctactgggcagagttctggagccagtaccggattaatgtcactgaagtgaacccactg
ggtgccagcacacgcctgctggatgtgagcttttgggacatcttgcgtcctgacccaccc
gaggggctgcgggtggagtcagtacctggttacccacgacgcctgcatgctagctggatg
taccccacctcttggccccaaaagccacacttcacgctcaagttccgactgcagtaccgt
ccagcacagcatccggcctggtccacggtggagcccattgacttggaagaggtgatcaca
gatgctgtggctgggctgccccatgaggtgcgggtcagtgccagggattttctggatgca
gggacctggagcacctggagcccagtggtcttggggactccgagcactgagtccctaaca
aatgagattcctgatccgggcaagatatacacacagctggtggacagcatggctcctccg
aggccttctttgcagccagaccctcggccactgaatcacagggaccctctggagcagatg
gttgtgttagtgtctttgggagtcttctctttcctgggactggcagctggggccctcaca
ctggggttctgttgcctttttaggctgaggctgaggtggagcaggaaggatggaccccaa
aagcctggattcctggcctcaatgattccagctgacaagcttccaggtattccagacctg
tag

KEGG   Heterocephalus glaber (naked mole rat): 101709169
Entry
101709169         CDS       T02812                                 

Gene name
Ifngr1
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04066  HIF-1 signaling pathway
hgl04217  Necroptosis
hgl04380  Osteoclast differentiation
hgl04630  JAK-STAT signaling pathway
hgl04650  Natural killer cell mediated cytotoxicity
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl05140  Leishmaniasis
hgl05142  Chagas disease
hgl05145  Toxoplasmosis
hgl05152  Tuberculosis
hgl05164  Influenza A
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05200  Pathways in cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hgl05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101709169 (Ifngr1)
   04066 HIF-1 signaling pathway
    101709169 (Ifngr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101709169 (Ifngr1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101709169 (Ifngr1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101709169 (Ifngr1)
   04658 Th1 and Th2 cell differentiation
    101709169 (Ifngr1)
   04659 Th17 cell differentiation
    101709169 (Ifngr1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101709169 (Ifngr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101709169 (Ifngr1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101709169 (Ifngr1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101709169 (Ifngr1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101709169 (Ifngr1)
  09172 Infectious disease: viral
   05164 Influenza A
    101709169 (Ifngr1)
   05168 Herpes simplex virus 1 infection
    101709169 (Ifngr1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101709169 (Ifngr1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101709169 (Ifngr1)
   05140 Leishmaniasis
    101709169 (Ifngr1)
   05142 Chagas disease
    101709169 (Ifngr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101709169 (Ifngr1)
   04090 CD molecules [BR:hgl04090]
    101709169 (Ifngr1)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IFN receptor family
   101709169 (Ifngr1)
CD molecules [BR:hgl04090]
 Proteins
  101709169 (Ifngr1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind Peptidase_M56 Comm
Other DBs
NCBI-GeneID: 101709169
NCBI-ProteinID: XP_004871529
LinkDB
Position
Un
AA seq 469 aa
MGAGMAVLVLLILLVRSGSRAEMSTAEPEPSSVPVPTNVRIQSYNLNPTLYWDYQSMPQT
PVFTVEVKSYGRKTWIYACSNTSDHHCNILNVHDPDLPIWAKVKARIGQKESAYVESKDF
VICKEGKVGPPELTVTQEEDHVIIDVVDPIVHVSGEKQEAMYDACYTLMYKVYVRENTSK
TLKHDLAEDDCLYSLCQLRIPVPSLNSEYCVSAEGFSKDWEITTERSEEDCITIRSSSIK
DYIWILIIVALLLFLVFILVFAYCYFKKNPCKKKNIMLPKSLLSVVKSATSETKPESKYV
TFITSYQPIAPENQALVSGEEVSAGTVPGASTEGGRGGEEHSGELSTQTEALMPDASGSD
WALTENSLHSNSNQSEPCSVVVSSYHSRNGSDSGLVGSDSFVSDSEIPPSNKTQVKTEGQ
EPVIVLQRSAPTSFGYDKPHVLVDVLVGDGGGKETLVGYRLTTDSREFS
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgggtgctggcatggctgtcctcgtcctcctgatccttcttgtgcggtccgggagcagg
gctgagatgagcaccgcggaaccagagccgtcctcggtgcctgtgccaaccaatgttaga
attcagtcctataatttgaacccaacgctgtattgggactaccagagcatgccccagact
cctgtttttaccgtagaggtaaagtcctacgggcggaaaacatggatatatgcctgcagc
aatacatctgatcatcattgcaatattcttaatgttcatgacccagatcttcctatttgg
gccaaagttaaagctagaattggacaaaaagaatctgcttatgtagagtccaaagacttt
gtcatttgcaaagaaggaaaggttggaccacctgaactaactgttacgcaggaggaagac
catgtcattattgatgtggttgacccaatagttcatgtaagtggagaaaagcaggaagcc
atgtatgatgcctgttacacattaatgtacaaagtgtatgtgagagagaacacaagtaag
accctaaaacatgaccttgcagaagatgactgcctctacagtctatgccaattaagaatt
ccagtgccctcactgaattctgagtactgtgtttcagcagaaggattctcaaaggattgg
gaaattacaactgaaaggtcagaagaagattgtattaccattcgtagtagcagcataaaa
gattatatttggattctgattattgttgccttactactctttctagtatttatcctagta
tttgcatattgttattttaagaagaacccatgcaagaagaaaaatataatgttacccaaa
tctttgctctcagtggtaaaaagcgccacttcagagacaaaacctgaatcgaaatacgtg
acattcatcacatcgtatcagccgattgccccagaaaaccaggcgttggtctctggagag
gaggtgtccgcagggacagtgccgggcgccagcactgaaggtggccggggcggagaggag
cacagcggagagctgtccacccagacagaggcgctgatgccggatgcaagcggctctgac
tgggcgctgacagagaattctttgcattcgaatagtaaccagtcggaaccctgcagtgta
gtcgtaagctcctatcactcccgaaatggttccgacagcggcctcgtgggttcagacagc
ttcgtatccgactctgaaatccctccaagcaataaaacccaagtaaagacagaaggccaa
gagcctgtcatcgttctgcagaggagcgcccccacctcctttggttacgataagccacac
gtgctggtggatgtgcttgtgggggacggtggtggcaaagagactttggttggttataga
cttacaacagattcccgagaattttcttaa

KEGG   Heterocephalus glaber (naked mole rat): 101710077
Entry
101710077         CDS       T02812                                 

Gene name
Il7r
Definition
(RefSeq) interleukin 7 receptor
  KO
K05072  interleukin 7 receptor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04068  FoxO signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04640  Hematopoietic cell lineage
hgl05200  Pathways in cancer
hgl05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101710077 (Il7r)
   04068 FoxO signaling pathway
    101710077 (Il7r)
   04151 PI3K-Akt signaling pathway
    101710077 (Il7r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101710077 (Il7r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101710077 (Il7r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101710077 (Il7r)
  09163 Immune disease
   05340 Primary immunodeficiency
    101710077 (Il7r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101710077 (Il7r)
   04090 CD molecules [BR:hgl04090]
    101710077 (Il7r)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL2 receptor family
   101710077 (Il7r)
CD molecules [BR:hgl04090]
 Proteins
  101710077 (Il7r)
SSDB
Motif
Pfam: FN3_7 fn3
Other DBs
NCBI-GeneID: 101710077
NCBI-ProteinID: XP_004848684
LinkDB
Position
Un
AA seq 461 aa
MTILGTAFAIVFYLLYTVSGESGYAQNGDLEDAESDTDYSFSCYAQLEVDGSQHSLTCAF
DDPDINSTNLELEICKGFVGVECMNFSKLQEEKYFIKTKKFLLVGESKICVKLGEETLAC
KTVEIAHLVKPEAPFDMKVIYRDRANDFEVTFNTSHLQKKYVKQLMHDVAYCQEKNGNNW
THMNIFNTRLTLPLRKLQSDAMYEIKVRSIPDSDYYKGFWSEWSPSSHFKTPEANNAEEM
NPVLSTISITSFFSVVLLVILSCALWKKRIKPIVWPSLPDHKKTLEQLCKKPEKNLNVSF
NPEHFLDCQIHKVDDIQSRDEVESFLQDTLSPQFEESEKQGFAGSGQGHNWPSQIPVITS
EAFKGELPFGCPTGNISACNASMHPSFWSPDCRKGIRSGSHMYQGLLLSPGTTDSTVLPP
FPLQSGILTMNPGIQGQPILTSLKQSQEEAYVTMSSFYKNQ
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgacaattctaggtacagcttttgctatagttttctatttactttatactgtttctgga
gaaagtggctatgcacagaatggagatttagaagatgcagagtcagatacagactactca
ttctcctgctatgctcagttggaagtggatggatcccagcactcactgacctgtgctttc
gatgacccagacatcaacagcaccaatctggaacttgaaatatgtaagggctttgttgga
gtagaatgtatgaattttagtaaactccaagaagagaaatatttcatcaagacaaagaaa
ttcttattggttggtgaaagcaagatatgtgtgaagcttggagaagagactctagcttgt
aaaacagtggaaatagcccacttagttaaacctgaggctccttttgacatgaaagttatc
tatcgtgatagagcaaatgactttgaagtgacatttaacacatcacatttgcaaaaaaaa
tatgtaaaacaattaatgcatgatgtagcctactgccaagaaaaaaatggaaacaactgg
acgcatatgaatatattcaacacaaggctgacactcccactgagaaagctacaatctgat
gcaatgtatgagattaaagttcgatccattcctgatagtgactattacaaaggcttctgg
agtgaatggagtccaagttcccacttcaaaactccagaggccaataatgcagaagagatg
aatcctgttttatcaactatcagcattaccagctttttctctgtggttctgttggtcatc
ttatcctgtgcattatggaaaaaaaggattaagcctattgtatggccaagtctgcctgat
cataagaaaactctggaacaactgtgtaagaaaccagaaaaaaatttgaatgtgagtttc
aatcctgaacattttctggactgccagattcataaggttgatgacattcaatctagagat
gaagtggaaagctttctgcaagacactctttccccacaatttgaggagtctgagaaacag
ggatttgcagggagtgggcaaggacacaactggccatctcagattccagttatcacctca
gaagctttcaaaggagagttaccctttggatgccctactggaaacatcagcgcatgtaat
gcctctatgcacccctctttctggtctccagactgcaggaagggtatcaggagtggctct
cacatgtaccagggattgctgcttagtcctggaactacagacagcactgtgctcccacca
tttcctctccaatcaggaatcctgacaatgaacccaggtattcagggacagcccatcctc
acttctttgaaacaaagtcaggaagaagcttatgtcaccatgtccagcttttacaaaaac
cagtga

KEGG   Heterocephalus glaber (naked mole rat): 101710668
Entry
101710668         CDS       T02812                                 

Gene name
Epor
Definition
(RefSeq) erythropoietin receptor
  KO
K05079  erythropoietin receptor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04151  PI3K-Akt signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04640  Hematopoietic cell lineage
hgl05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101710668 (Epor)
   04151 PI3K-Akt signaling pathway
    101710668 (Epor)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101710668 (Epor)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101710668 (Epor)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101710668 (Epor)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101710668 (Epor)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  Prolactin receptor family
   101710668 (Epor)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Other DBs
NCBI-GeneID: 101710668
NCBI-ProteinID: XP_004865640
LinkDB
Position
Un
AA seq 523 aa
MDHLGAPLWPRVGPLCLLLAGAAWAPLPNSPDPKFESKAALLVARGPQELLCFTERLEDL
VCFWEEEASSGVTSSNYTFSYQLEGEPRKPCHLHQAPTTLGAVRFWCSLPTADTSSFVPL
ELRVTEASSGSPRYHRVIHINEVVLLDAPTGLQARRAEESGQVMLRWLPPPGAPMTTHIR
YEVDVSAGSSAGGAQRRRASGRPSPRPRPQVEILEGRTECVLSNLRGATRYTFAVRARMA
EPSFSGFWSAWSEPASLLTASDLDPLILTLSLILVLIVLLLAVLALLSHRRTLKQKIWPG
IPSPESEFEGLFTTHKGNFQLWLSQHDSCLWWNPCTPFPEEPPTRLEVLSERCWGVPQVV
EPGADDVGPLLQLVGREHAQDSYLVLDKWLLPQSPHGKGLPGPGGCTDIVAVDKDSEASS
CSSALALKPEPEEALATSFEYTILDPSSQLLRPRVLCPELPPTPPHLKYLYLVVSDSGIS
TDYSSGGSQGAQGVPSDDTYSNSYENSLVPTPGPLTPSYVACS
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggaccacctcggggcgcccctctggccccgagttggccccctctgtctcctgctggct
ggggcagcctgggcgcccctacccaactctccagaccccaaatttgagagcaaagcggcc
ctgctggtggcccgagggccccaagagcttctctgcttcacggagcggctggaggacttg
gtgtgtttctgggaggaagaagcaagctccggggtcacctccagcaactataccttctcc
taccagctcgagggcgagcctcggaagccctgtcacctgcaccaggcgcccaccaccctg
ggtgccgtgcgcttctggtgttcgctgcccacggccgacacgtcgagtttcgtgcccctg
gagctgcgcgtcacggaggcctcctccggctccccgcgttatcaccgggtcatccacatc
aacgaagtggtgctcctggacgcccccacggggctgcaggcacggcgggcggaggagagc
ggccaagtgatgcttcgctggctgccgccgcctggggcacccatgacaacccacatccgc
tacgaggtggacgtctctgcgggcagcagtgcagggggagcgcagagaaggcgtgcctct
ggacgcccctcccctcggccccgcccccaggtggagatcctggagggccgcactgagtgc
gtgctcagcaacctgcgtggcgccacgcgctacacctttgcggttcgagcgcgtatggcc
gagcccagcttcagcggcttctggagcgcctggtctgagcctgcgtcgctgctgacggct
agcgacctggaccccctcatcctgacgctgtccctcatcctcgtgctcatcgtgctgctg
ctggccgtgcttgccctgctgtcccaccgccggactctgaagcagaagatctggcctgga
atcccaagccccgagagtgagtttgaaggcctcttcactacccataagggtaacttccag
ctctggctgtcacagcatgacagctgtctgtggtggaacccctgcaccccctttccggag
gaaccgcccacccgcctggaagtcctctccgagcgctgctggggggtgccccaggtagtt
gagccgggggcagatgatgtggggcccctgctgcagctggtgggccgtgagcatgcccag
gactcctacctggtgctggacaagtggctgttgccccagagcccgcacggcaagggcctc
ccagggcctggaggctgcactgacattgtggctgtggacaaagactccgaagcgtcttcc
tgctcatctgctttggccttgaagcccgagccggaggaggccctggcaaccagctttgaa
tacaccattctggaccccagctcccagctcttgcgcccacgggtgctgtgtcccgagctg
ccccccaccccaccccacctgaagtacctgtacctcgtggtgtctgactctgggatctca
actgattacagctcagggggctcccagggagcccagggggtcccatccgatgacacctac
tcgaactcctatgagaacagccttgtccctacccctgggcccctcacccccagctacgtg
gcctgctcgtag

KEGG   Heterocephalus glaber (naked mole rat): 101715243
Entry
101715243         CDS       T02812                                 

Gene name
Il2rg
Definition
(RefSeq) interleukin 2 receptor subunit gamma
  KO
K05070  interleukin 2 receptor gamma
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04061  Viral protein interaction with cytokine and cytokine receptor
hgl04144  Endocytosis
hgl04151  PI3K-Akt signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl05162  Measles
hgl05166  Human T-cell leukemia virus 1 infection
hgl05200  Pathways in cancer
hgl05321  Inflammatory bowel disease
hgl05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101715243 (Il2rg)
   04151 PI3K-Akt signaling pathway
    101715243 (Il2rg)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101715243 (Il2rg)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101715243 (Il2rg)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101715243 (Il2rg)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101715243 (Il2rg)
   04659 Th17 cell differentiation
    101715243 (Il2rg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101715243 (Il2rg)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101715243 (Il2rg)
   05340 Primary immunodeficiency
    101715243 (Il2rg)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101715243 (Il2rg)
   05162 Measles
    101715243 (Il2rg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101715243 (Il2rg)
   04090 CD molecules [BR:hgl04090]
    101715243 (Il2rg)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL2 receptor family
   101715243 (Il2rg)
CD molecules [BR:hgl04090]
 Proteins
  101715243 (Il2rg)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind
Other DBs
NCBI-GeneID: 101715243
NCBI-ProteinID: XP_004921272
LinkDB
Position
Un
AA seq 376 aa
MLKPSLPLRSLLLLQLPLLGMGLNSTVLKPSGNEDTTADSFLTSETPRSLNSSILPLPEV
QCFVFNGEYMNCTWNGSSEPRPTNLTLRYGYKNSDNYKVQECGHYLFSKEITSGCWFQEN
EIHLYETFVIQLQDPREPRRQMEQKLKLQNLVIPWAPENLTLRNLSESQLELSWSNRYSL
DRCLQHLVQYRSDWDSRWTEQQVDHKQRFSLPSVDGQKLYTFRVQSRFNPLCGSAQRWSE
WSHPVHWGSNTSKESPWLFITKAVVIPVGSMGLIISLFFVYCWLERTMPRIPTLKHLEDL
VTEYHGNFSAWSGVSKGLAESLQPDYSERLCHVSEVPPKGEAXGEGPGGSSCSQPDRAPP
HYTLKPETPKTRVPIP
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgttgaagccatcattaccactgagatccctcttacttctgcagctacctttgctgggc
atggggctgaactcgacggtcctcaagcccagtgggaatgaagacacgacagctgattcc
ttcttgacctctgagacccccaggtctctcaacagttccatcctgcccctcccagaggtt
cagtgctttgtattcaatggcgagtacatgaattgcacttggaatggcagctctgagccc
cggcctaccaacctgactctgcgatatgggtacaagaactctgataattataaagtccag
gagtgtggtcattatcttttctcaaaagagattacttctggctgttggtttcaagaaaat
gagatccatctctatgaaacatttgttatccagctgcaagacccacgagaacccaggagg
cagatggaacagaagctaaaactgcagaacctggtgatcccttgggctccggagaatcta
acacttcgcaacctgagtgaatcccagctagaactgagctggagcaacagatactccttg
gaccgctgtttgcagcatttggtgcagtatcggagcgactgggatagcagatggactgaa
caacaagtggatcacaaacagcgcttctcccttcctagtgtggatgggcagaaactgtac
acattccgggttcagagccgctttaacccactctgtggaagtgctcagcgttggagtgaa
tggagccacccagtccactggggaagcaatacttcaaaggagagtccgtggttatttata
accaaagctgtggttatccctgttggctccatgggactgattattagcctcttctttgtg
tattgctggctggaacggacaatgcctcgaattcccaccctcaagcacctagaggatctg
gtcactgaataccatgggaacttttcggcctggagtggtgtgtctaagggactggctgag
agtctgcaaccagactacagtgaacggctctgccatgtcagtgaggtgcccccaaaagga
gaggccncaggggaggggcctgggggctcctcctgcagccagcccgaccgggctccccca
cattacacccttaagcccgaaacccccaaaacccgagtcccaattccctga

KEGG   Heterocephalus glaber (naked mole rat): 101716037
Entry
101716037         CDS       T02812                                 

Gene name
Ghr
Definition
(RefSeq) growth hormone receptor
  KO
K05080  growth hormone receptor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04080  Neuroactive ligand-receptor interaction
hgl04151  PI3K-Akt signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101716037 (Ghr)
   04151 PI3K-Akt signaling pathway
    101716037 (Ghr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101716037 (Ghr)
   04060 Cytokine-cytokine receptor interaction
    101716037 (Ghr)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    101716037 (Ghr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101716037 (Ghr)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  Prolactin receptor family
   101716037 (Ghr)
SSDB
Motif
Pfam: GHBP EpoR_lig-bind fn3 Bac_rhamnosid_C IL6Ra-bind DUF4605
Other DBs
NCBI-GeneID: 101716037
NCBI-ProteinID: XP_004848623
LinkDB
Position
Un
AA seq 633 aa
MDLWQLLLTLALAGASNAFAGREATTATSDSAPPSLQRVNASLETNSSGNPKITRCRSPE
LETFSCYWTDGGHHDLKMPGFIQLFYVKRSIQEQNLEWKECPDYVSAGENSCYFNSSYTS
IWKPYCVKLTSNGGTVDKKCFSVDEIVQPDPPIGLNWTLLNTSVTAIYGDIQVRWEPPAS
TDVDKGWIMLEYELQFKQTNETQWKMMDPVISTSVPLYSLKMDKEYEVRVRCRQKHSEKY
GEFSEVLYITLPQLSSFTCEEEFQFPWFLIMIFGIFGLMVMLLVVIFSKQQRIKMLILPP
VPVPKIKGVDPDLLKEGKLEEVNTILAIHDNSKPQFYNDDSWVEFIELDFDDPDEKTEGS
DTDRLLSSDHQKSLNILGAKDDDSGRTSCYEPDILETDFNASDVCVGTSEVVRPDKLKGE
ADFLCLDEKNQNNSPYDASPDPQQASVIPTEEDKPQLLLIGKTESTNQDAPSQISNPSSL
ANMDFYAQVSDITPAGSVVLSPGQKNKAGMSHCDTHPEANFIKDNANFFKGDAKKCVVMT
PHIEVKSHVEPSFNQEDTYITTESLTTAAEKSGDAEQPPSSEMALPDYTSIHIVQSPQGL
ILNAAALSLPLPDKEFLSSCGYVSTDQLNKIMP
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggatctttggcagttgctattgaccttggcactggcaggtgcaagcaatgcttttgct
gggagagaggccacaacagctacttctgacagtgcacccccaagtctgcaaagagttaat
gcaagcctggaaacaaattcttctgggaaccctaagatcaccaggtgccgttcacctgaa
ctagagacattttcatgctactggacagatgggggtcatcatgatttaaagatgccagga
ttcatacagctgttctatgttaaaaggagcattcaagaacagaacctagaatggaaagaa
tgccctgattatgtctctgccggagaaaatagctgttactttaactcatcatatacctcc
atttggaaaccctactgtgtcaagctaactagtaatggtggtacagtggataaaaaatgt
ttctctgttgatgaaatagtgcaacctgatccacccattggcctcaactggactttactg
aacaccagtgtaacggcgatttatggggatatccaagtgagatgggaaccaccagccagt
acagatgttgataagggatggataatgctggaatatgaacttcaatttaaacaaacaaat
gaaactcaatggaaaatgatggaccctgtaatatcaacatcagttccactgtactcattg
aaaatggataaagaatatgaagttcgtgtaagatgcagacaaaaacactctgaaaaatat
ggcgagttcagtgaagtgctctacataacacttcctcagttgagctcatttacgtgtgaa
gaagaattccagtttccatggttcttaattatgatctttggaatatttggactaatggtg
atgctacttgtggtcatattttctaaacagcaaaggattaagatgctgattttgccccca
gttccagttccaaagattaaaggagttgatccagatctcctcaaggaaggaaaattagag
gaggtgaacacaatcttagccattcatgataactctaaacctcagttctacaacgatgac
tcttgggttgaatttattgagctagattttgatgaccctgatgaaaagactgaaggttca
gacacagacagacttctcagcagtgaccatcaaaaatcacttaatatccttggagcaaag
gatgatgactctggacgtactagctgctatgaacctgatattctggagactgatttcaat
gccagtgatgtgtgtgttggcacctctgaggttgttcggccagacaagctaaaaggggaa
gctgatttcttgtgccttgatgagaagaatcaaaataattcaccttatgatgcttctcct
gaccctcagcaggccagtgttattccaacagaggaagacaaaccacaactacttcttatt
ggtaaaactgagtcaactaaccaagatgccccttctcagataagcaatcctagttcactg
gcaaacatggacttttatgcccaggtaagcgacattacaccagcaggaagtgtagtcctt
tccccaggccaaaagaataaggcaggaatgtcccactgtgatacacatcctgaggcaaac
ttcatcaaagataatgccaacttcttcaagggagatgccaaaaagtgcgttgtcatgacc
cctcacatcgaggtcaagtcacatgtagaaccaagctttaaccaggaggatacttacatc
accacagaaagccttaccactgctgctgagaagtctggggatgcagaacagcctccaagc
tctgaaatggctctcccagattatacctccattcatatagtgcagtctccacagggcctc
atactcaacgcggctgcattgtccttgcctttgcctgacaaagaatttctctcatcgtgt
ggctatgtgagcacagaccaactgaacaaaatcatgccgtag

KEGG   Heterocephalus glaber (naked mole rat): 101717608
Entry
101717608         CDS       T02812                                 

Gene name
Il12rb2
Definition
(RefSeq) interleukin 12 receptor subunit beta 2
  KO
K05064  interleukin 12 receptor beta-2
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl05200  Pathways in cancer
hgl05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101717608 (Il12rb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101717608 (Il12rb2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101717608 (Il12rb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101717608 (Il12rb2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101717608 (Il12rb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101717608 (Il12rb2)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL6/12 receptor family
   101717608 (Il12rb2)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind
Other DBs
NCBI-GeneID: 101717608
NCBI-ProteinID: XP_004841637
LinkDB
Position
Un
AA seq 825 aa
MVLAVRGCSLASVFVTMWLLVRAQIDVCRLGDVTVRPASVVPLGVAVEISCSLKPGQSCL
QGSAFHRLILYKSGTEIGSHQGPAFSFRVSDLPLGTAVFVCKAVCATGTLALVCGAEVSV
GAAPECPRNVSCVQEGQHGAVACSWDPGRDTRLSHNYTLQLHGPGNLIWQKQCGNYCRRL
DLGISLSLELLESSFTAEVTAANHLGNASSGPSTFTFLDIVKPLPPSDLRVQFPNGSGSR
CTLQWTDEAWVLLNRLRYRPGDSRSWRTVSVTDAQGRHEGLRLEPFTDYEFQVSSKLRLS
GGGWSNWSEPLRARTPEEEPSGTLDVWYRSQLAAGGRQVSVFWKSLSLAEARGRILHYQV
ALQEVSGRAAMLWNVTRGTSWTGVLPSTGTWTTAVSATNSKGSSRPAQVTIGNPCGTGSL
APREVSASSRGEDSVSVTWQPPGRGGPAVQQYLVEWTALPGRGRGSQAPLSWLRIPASNR
SAVISESIEPYVCYEIRVFALSGDRGGCSSVLGDLKHRAPAIGPHIEAITEDETGVLVSW
SPRPAGEQVGCVVHLRIYWRERGSSTPPRLQEVPCWPSRSSHPLSGLWHGVTYVLWMTAV
TAAGEGPRGNEREFRLQRGASWSAVLAVSACVAVLTLGVLFTGCFQQKALLLLSALRPQW
CRPGIPDPANSTWARRLVLEEERTPLPVDGTQTEPEPLIISEVLPGATAVFRAAQCPRWP
EEGQGDRARLDCTEGPVGMGCSPPPVGPLYRALAVTLPGPDGYLPASPGVLATPESPLPE
PEQEPGPPPVTLSIFTARSLQPVGGACGPRLTLDRLRLGCDSLAL
NT seq 2478 nt   +upstreamnt  +downstreamnt
atggtgcttgcagtgaggggctgctcgctggcatctgttttcgtaaccatgtggctgctg
gtcagagcacaaatagacgtgtgccggctgggcgacgtcaccgtgagaccggccagtgtc
gtgcctctcggcgtggcggtggagatctcctgctcgctgaagcccggccaaagctgcctg
caaggctccgccttccacagactcatcctctacaagtccggcacggaaatcggctcccac
cagggcccggccttcagcttccgagtgtcggacctgcccctgggcacagctgtgtttgtc
tgcaaagcggtctgcgccacaggcaccctagccctggtgtgcggggcggaggtctccgtg
ggcgctgctccagagtgccctcgaaatgtgtcttgtgtgcaggagggacagcatggagcc
gtggcctgctcctgggaccccggccgagatacccgcctgagccataactacacgctacag
ctacatggacccggaaatttaatttggcagaagcagtgcgggaattactgtcgtcgcctg
gaccttggaatcagcctcagccttgaactacttgagtcaagtttcacagctgaggttacc
gctgcaaaccacctcggaaacgcttcctcgggcccatcgacgttcacattcctggacata
gtgaagccgcttcctccgagtgacctcagagtccagttcccgaatgggtctggcagccgc
tgtaccctccagtggacggacgaggcctgggtgctgctcaaccggctccggtaccggccc
ggggacagcagatcctggaggacggtcagcgtgaccgacgcccaggggagacacgaaggg
cttcgcctggagcccttcaccgactacgaattccaggtctcctctaagctgcgtctttcc
ggcggaggctggagcaactggagcgaacccttgcgggcacgcacacccgaggaagagccc
tcggggacgctggacgtgtggtaccggagccagctggcagccggcggccggcaggtgtcc
gtgttctggaagagcctgagcctggcagaggcgagagggagaatcctgcactaccaggtg
gccctgcaggaggtgtcagggagggcagccatgctgtggaacgtcacacgaggcacctcc
tggaccggggtcctccccagcaccgggacttggaccacagctgtgtctgccaccaactcc
aaaggaagctcccggccggctcaagtgaccatagggaacccgtgtggcacagggtcgctg
gctccccgcgaggtctccgcgagctcccggggcgaggacagcgtctcggtgacctggcag
cctcccgggcgcggggggcccgccgtgcagcagtacctggtggagtggacggcgctgccc
gggcgcgggcgcggctcgcaggccccgctgagctggctgcggatccccgcctccaacagg
tctgccgtcatctcagagagcatcgagccctacgtgtgttacgagatccgcgtgttcgcg
ctgtcgggggaccgaggcgggtgcagctctgtactgggcgacttaaaacacagagcaccg
gccatcggcccccacatcgaggccatcaccgaggatgagacaggcgtgttggtctcctgg
agccccaggccggccggggagcaggtgggctgtgtcgtgcacctccggatctactggcgg
gaacggggctccagcaccccgccgaggctccaggaggtcccctgctggccctccaggagc
tcccacccgctctccggcctgtggcacggggtgacctacgtgctgtggatgacggcggtg
acagcagctggcgaggggccccggggaaacgaaagggaattccgcctgcagagaggagcc
agctggagcgcggtcctggctgtgagtgcctgtgtggctgtcctcaccctgggcgtcctc
ttcaccggctgcttccagcaaaaggcgctgctgctgctctcggcgctcaggccacagtgg
tgccgcccggggatcccagacccggccaacagcacctgggcccggaggctcgtgctggag
gaggagaggaccccgctgccggtggacgggacgcagacggagccggagcccttgatcatc
agtgaggtcctgcctggcgcgactgcagtcttcagagctgcccagtgcccccgctggcct
gaggaggggcagggagaccgggcccgcctcgactgcacagaggggccggtgggcatgggc
tgcagcccgccccctgtggggcccctgtacagggcgctggcggtgactctcccgggccct
gacggctacctccccgccagccctggggtcctggccaccccagagtccccgctccctgag
cccgagcaggagccggggccaccacctgtcaccctctccatcttcacggcccgctccctc
cagcctgtgggtggtgcctgcggcccgaggctgaccctggaccggctcaggctgggctgt
gactccctggcgctctag

KEGG   Heterocephalus glaber (naked mole rat): 101721151
Entry
101721151         CDS       T02812                                 

Gene name
Pdgfrb
Definition
(RefSeq) platelet derived growth factor receptor beta
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl04010  MAPK signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04020  Calcium signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04510  Focal adhesion
hgl04540  Gap junction
hgl04630  JAK-STAT signaling pathway
hgl04810  Regulation of actin cytoskeleton
hgl05165  Human papillomavirus infection
hgl05200  Pathways in cancer
hgl05206  MicroRNAs in cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05230  Central carbon metabolism in cancer
hgl05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101721151 (Pdgfrb)
   04014 Ras signaling pathway
    101721151 (Pdgfrb)
   04015 Rap1 signaling pathway
    101721151 (Pdgfrb)
   04630 JAK-STAT signaling pathway
    101721151 (Pdgfrb)
   04020 Calcium signaling pathway
    101721151 (Pdgfrb)
   04072 Phospholipase D signaling pathway
    101721151 (Pdgfrb)
   04151 PI3K-Akt signaling pathway
    101721151 (Pdgfrb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101721151 (Pdgfrb)
   04540 Gap junction
    101721151 (Pdgfrb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101721151 (Pdgfrb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101721151 (Pdgfrb)
   05206 MicroRNAs in cancer
    101721151 (Pdgfrb)
   05230 Central carbon metabolism in cancer
    101721151 (Pdgfrb)
   05231 Choline metabolism in cancer
    101721151 (Pdgfrb)
  09162 Cancer: specific types
   05214 Glioma
    101721151 (Pdgfrb)
   05218 Melanoma
    101721151 (Pdgfrb)
   05215 Prostate cancer
    101721151 (Pdgfrb)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101721151 (Pdgfrb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101721151 (Pdgfrb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101721151 (Pdgfrb)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hgl04090]
    101721151 (Pdgfrb)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101721151 (Pdgfrb)
Protein kinases [BR:hgl01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101721151 (Pdgfrb)
CD molecules [BR:hgl04090]
 Proteins
  101721151 (Pdgfrb)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 I-set Ig_2 V-set C1-set Ig_6 TrmE_N
Other DBs
NCBI-GeneID: 101721151
NCBI-ProteinID: XP_004854469
LinkDB
Position
Un
AA seq 1106 aa
MQLPCVMPSPGLQGQLLLLPLLLLLGPQISQGLVITPPGPELVLNLSSTFVLTCSGSAPV
VWERMSQVPPQEMVVTQDGTFTSVLTLTNVTGGDTGEYFCTYNSSVELEPSEQKRLYIFV
PDPSMSFLPIDPEDTFVFVTEITDPTIPCRVTDPQLVVTLHEKKEDIPLPIPYDHQRGFI
GTLEDKTYICKTTIGDREVDSDAYYVYSLQVSSINVSVNAVQTVVRQGENITIMCIVTGN
EVVNFEWMYPRKESGQQVESVTDFLPDMPNHIRSILHIQDAELGDSGTYICNVSESVNEH
RDEKAVNVTVVERGYVRLLQGLGAVEIAELHQSRTLQVMIEAYPPPTVLWFKDNRTLGDS
SVGEIVLSTRNVSETRYVSELTLVRVKVAEAGSYTMRAFHEDDEDQLSFKLQVNVPVRVL
ELSESHPASGEQTVRCRGRGMPQPHVTWFTCRDLKRCPHELPPTPLGNSSEEESHLETNM
TYWAEEQEYEVVSTLRLRHVDQQLSVFCMVHNLLGQDVQEVTVVPHSLPFKVVVISAILA
LVVLTIISLIILIILWQKKPRYEIRWKVIESVSSDGHEYIYVDPVQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLGHSQSTMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHLDKRRPASIELYSNAL
PVGFSLPSPVSLSGESDGGYMDMSKDESVDYVPMLDMKGDIKYADIESSNYMAPYDNYVP
SAPERTYRATLINESPLLSYTDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNEQFYNAIKRGYRMAQPAHAADEIYEIMQKCWEEKFEIRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDND
YIIPLPDPKPEVAEEGRLEGSPSIASSTLHEANTSSTISCDSPLDPQEEPEPEPEPEPQV
EPEPELEQPQNSGCPGPQVEVEDSFL
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgcagcttccatgtgtgatgccatctccgggccttcaaggccagttgctgttgctgcca
ctgctgttgctgctgggaccacagatctcccaaggcctggtcatcacgccccctgggcca
gagctggttctcaatctctctagcacctttgttctgacctgctcgggttcggctccagtg
gtgtgggaacgaatgtcccaggtacccccacaggaaatggtcgtgacccaggatggcacc
ttcaccagcgtgctgacactgaccaatgtcactggcggagacacaggagaatacttttgc
acctacaacagttctgtcgagctggagcccagtgagcagaagcggctgtacatctttgtg
ccagatcccagcatgagcttcctcccgatagaccctgaggatacatttgtctttgtcacg
gagataactgaccccaccatcccatgccgagttacagacccccagctggtggtgacactg
catgagaagaaagaagacatccctctacctattccctatgaccaccagcgaggtttcatt
ggtaccttggaggacaagacctacatctgcaaaaccaccattggggacagggaagtggat
tctgatgcctactatgtctacagcctccaggtgtcatccatcaatgtctctgtgaatgca
gtacagactgtggtccgccagggtgagaacatcactatcatgtgcattgtgacggggaat
gaggtggtcaactttgagtggatgtacccccgaaaggagagtggacagcaggtcgagtcg
gtgacggacttcctccccgacatgcccaaccacattcgctccatcctgcacatccaagac
gccgagctgggcgactcaggaacctacatctgcaacgtgtctgagagtgtgaatgagcac
cgagacgagaaggctgtcaacgtcacagtggtcgagagaggctacgtgaggctgctgcaa
gggctgggtgcagtagaaattgctgagctgcaccagagccggacactgcaagtgatgatc
gaggcttaccctccgcccactgtcctatggttcaaagacaaccgcaccctgggtgactcc
agtgtcggcgagatagtcctgtccacacgcaatgtgtccgagacccggtatgtgtcggag
ctgacgctggttcgggtgaaggtggcagaggccggcagttacaccatgcgggccttccat
gaggatgatgaggaccagctctctttcaagctgcaggtcaatgtccctgtccgagtgctg
gagctgagtgagagccatcctgccagtggggagcagacagtccgctgtcgtgggcgaggc
atgccgcagccacatgtcacctggtttacctgcagagacctcaaaaggtgtcctcacgag
ctgccgcccacgcctctggggaacagttcggaagaggagagccatttggaaaccaacatg
acatattgggcggaggagcaggagtatgaggtggtgagcacgctgcgcctgcgccacgtg
gaccagcaactgtcggtgttctgcatggtacacaacctgctgggccaggacgtgcaggag
gtcaccgtggtgccgcattccctgcccttcaaggtggtggtgatctcagccatactggcc
ttggtggttctcaccatcatctccctcatcatcctcatcatactctggcagaagaaacca
cgctatgaaatccgatggaaggtgatcgagtctgtgagttccgatggccacgagtacatc
tacgtagacccggtgcagctgccctatgactccacgtgggagctgcctcgggaccagctt
gtgctcggacgcacgctcggctccggggcctttgggcaggtggtggaggccacagctcat
ggcctgggtcattcacagagcaccatgaaagtggccgtcaagatgctgaaatccacagcc
cgtagcagtgagaagcaagccctcatgtcggagctgaagatcatgagtcaccttgggccc
cacctgaacgtggtcaacctgctgggggcctgcaccaaaggaggacccatctacatcatc
accgagtactgccgctacggcgacctggtggactacttgcaccgcaataagcacaccttc
ctgcagcaccacttggacaagcgacgcccagccagcattgagctgtacagcaatgccttg
ccagtggggttctccttgcccagccccgtgtccttgagtggggagagtgatggtggctac
atggacatgagcaaggatgagtcagtggactacgtgcccatgctggacatgaaaggagac
atcaaatacgcagacattgagtcctccaactacatggctccttatgataactacgtcccc
tctgcccctgagaggacttatcgagcaactctgatcaatgagtccccgttgcttagctac
acagacctcgtgggcttcagctaccaggtggcaaatggcatggagttcctggcctccaag
aattgtgtccaccgagacctggcagccaggaatgtgctcatctgcgaaggcaagctagtc
aagatctgtgactttgggctggctcgagacatcatgcgagactcgaactacatctccaaa
ggcagcaccttcctgcctctgaagtggatggccccggagagcatcttcaacagcctctac
accaccctgagtgatgtgtggtcctttggcatcctcctctgggagatcttcacgctgggt
ggcacaccttacccagagctgcccatgaacgagcagttctacaatgccatcaagcggggc
taccgcatggcccagcctgctcatgccgccgatgagatctatgagatcatgcagaagtgc
tgggaagagaagtttgagattcggcctcccttctcccagctggtgctgcttctggagaga
ctgctgggtgagggttacaaaaagaagtaccagcaggttgacgaggagtttctgaggagc
gaccacccagccatccttcggtcccaagctcgcttgcctgggttccatggcctccggtct
cccctggacaccagctctgtcctctacactgctgtacagcccaacgagggtgacaatgac
tacatcatccccctgcctgaccccaaacccgaggttgctgaggagggccggctggaggga
tcccccagcattgccagctccaccctgcatgaagccaacacttcctctaccatctcctgt
gatagccccctggacccgcaagaggaaccagagccagagccagagcccgagccccaggtg
gagccagagccggagctggagcagcctcaaaattcaggctgccccgggccccaggtcgaa
gtggaggacagcttcctgtag

KEGG   Heterocephalus glaber (naked mole rat): 101721276
Entry
101721276         CDS       T02812                                 

Gene name
Il15ra
Definition
(RefSeq) interleukin 15 receptor subunit alpha
  KO
K05074  interleukin 15 receptor alpha
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
hgl04672  Intestinal immune network for IgA production
hgl05166  Human T-cell leukemia virus 1 infection
hgl05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101721276 (Il15ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101721276 (Il15ra)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    101721276 (Il15ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101721276 (Il15ra)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101721276 (Il15ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101721276 (Il15ra)
   04090 CD molecules [BR:hgl04090]
    101721276 (Il15ra)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL2 receptor family
   101721276 (Il15ra)
CD molecules [BR:hgl04090]
 Proteins
  101721276 (Il15ra)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 101721276
NCBI-ProteinID: XP_004854582
LinkDB
Position
Un
AA seq 327 aa
MLSHGSVTASHLSPALRGLKQKRKRMRQAGGRSQSCASHLPRPGHCTRGRPRARWRDTAG
RTAMVPRQLRGCRVHALAALLLQLLLLPPVTLGATCPSPTSVEHADIRVKSYNLHSRERY
VCNSGFKRKAGTSSLTECVFNKTTNITHWTTPNLKCIRDSSLTHQKPSTVVTARVTPELE
SPSLSGKEPAALSPKSDTTLATETATVPGPWLMSSKPPSVGTTGIGSHEPSQTPSQKTAV
TLEHTPSTSKETPGAHPDSSRYATVIIATSVPGSSLVVCLVSMLACYIKSRNTSQPRAVE
METMEAKPMTGGTSSREDDTGNDPLNL
NT seq 984 nt   +upstreamnt  +downstreamnt
atgctgagtcacggatctgtcaccgcttcgcacctctccccagccctcagggggctaaag
caaaagcgaaagcgaatgcgccaggcaggcggccggtcccagagctgcgctagccacctc
cccaggccgggccattgcacccgcggccggcccagggcacgctggcgggacactgcgggt
cggaccgccatggtcccgcggcagctccggggctgtcgagtccacgctctcgccgcgttg
ctgctacagctactgctcctgccgccggtgacgctgggtgccacgtgtcctagccccaca
tctgttgaacatgcagacattcgggtcaagagttacaatttacactccagggaacgatat
gtttgtaactctggtttcaagcggaaagctggcacatccagcttgaccgagtgtgtgttt
aacaagaccacaaacatcacccactggacaactcccaatctcaagtgcatcagagattcc
tccctgactcaccaaaagccctccacagtagtgacagcaagggtgaccccagagctagag
agcccctccctttctggaaaagagccagcagctttatctcccaagtcagacaccacactg
gccacagagacagccactgtaccaggcccctggctgatgtcatctaaaccaccttctgta
ggcaccacgggcataggcagtcacgagccctcccaaaccccatctcagaaaacagcagtg
accttggagcacacaccctctacttccaaggagacaccaggtgcccatccagatagctcc
agatatgctactgtaatcatcgcaacatctgttcccgggagttcacttgtagtgtgtttg
gtatcaatgctggcatgttacatcaaatcaaggaatacttcccagccacgtgctgttgaa
atggaaaccatggaagcaaagccaatgactggaggtaccagcagcagagaggacgacaca
ggaaatgatccactcaacctctaa

KEGG   Heterocephalus glaber (naked mole rat): 101721365
Entry
101721365         CDS       T02812                                 

Gene name
Il22ra1
Definition
(RefSeq) interleukin 22 receptor subunit alpha 1
  KO
K05138  interleukin 22 receptor alpha 1
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04061  Viral protein interaction with cytokine and cytokine receptor
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101721365 (Il22ra1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101721365 (Il22ra1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101721365 (Il22ra1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101721365 (Il22ra1)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL10/28 receptor family
   101721365 (Il22ra1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 101721365
NCBI-ProteinID: XP_004850645
LinkDB
Position
Un
AA seq 583 aa
MKTLLIILAVGSLAAHMAEDSPELLQHVKFQSSNFENILTWDGKPESIPGTVYSVEYKMY
GEPEWLAKVGCQQITQKSCNLTMETGNLTELYYARVTAISSGGWSATKMTERFNSLQHTT
IKPPDVTCVPQVRSIQMIVHPTPTPVHTTDGHQLTLEEIFQDLFYRLELHVNHTYQMVHH
LGGKQREFEFSGLTPDTEFLGSIVISVPTWSKESAPYVCRVKTLPDRTWTYFFSGAVLFF
AGFLVTMLFYLSNRYITKPPVPPNSLNVQRVLTFQPLRFIQEHVLIPALDLSSPSSLAQP
VQYAQVMISGPTEPPGATTLHNLPEMAYLGHSDVSILRAANVPPHQTLSPPSYNPKAAPE
VRPLSYTLQVAPDAKALLYTPQAFSTAPPPSYTSQATGDGGPASYGVCLEGCGTSLPPGM
PSSPKLLRPKGQLQKEAPVGSCIPGDFSLQGVSSVTMEGLQEAELFRSPLGVCTDRELDL
HVLHNGDPETLPYLQDPLSLLSSVQIEGHPVSLPLHPPSLSCSTSNQGPHPWGLLDSLVC
PKDEVQVSEAEPLRPGPRALELKQSTELDSLFQGLALTVQWES
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgaagacgctcctgatcatcctagctgtcggatccctagccgctcacatggctgaggac
tcccctgagcttcttcagcacgtgaaattccagtccagcaactttgaaaacatcctcaca
tgggacggcaagccagagagcatcccaggaacagtctacagcgtggaatacaagatgtac
ggagagccagaatggctggcaaaagtgggctgccagcagatcacccagaagtcctgcaac
ttgaccatggagacaggcaacctcactgagctttactatgccagggtcacggccatcagc
tcgggaggctggtcagccaccaagatgaccgaacggttcaactcgctacaacacactacc
atcaaaccaccagatgtgacttgtgtcccccaagtgagatccattcagatgattgtccat
cccactcccacacccgtgcacaccacagatggccaccagctcaccctggaggagatcttc
caggacctgttctaccgcttggagctccatgtcaaccacacctaccaaatggtacatcac
cttggagggaagcagcgagaatttgagttttctggcttgacccctgacacagaatttctt
gggagcatcgtgatttcagttccaacctggtccaaggagagcgccccttatgtgtgcaga
gtgaagacgctgccagatcggacgtggacctacttcttctcaggcgctgtcctcttcttc
gctggcttccttgtcaccatgcttttctacctgagcaacagatatatcaccaagccacct
gtgccccccaattccctgaatgtccagcgagtgctgactttccagccgctgcgcttcatc
caggagcacgtgctcatccccgccttggatctcagcagccccagcagtctggcccagccc
gtgcagtacgcccaggtcatgatctccgggcccacagagcctccaggggccacaacgcta
cacaacctgcctgagatggcctacttggggcactcggacgtctccatcctccgggctgcc
aatgtgccacctcaccagacgctctccccaccgtcctacaacccgaaggcagcccctgag
gtcaggcccctgtcctacactctgcaggtggcccctgatgccaaagccctactctacact
ccacaggccttctctacagctccgcctccctcctacacctcccaggccactggggatgga
gggcctgcttcctacggggtatgcctggaaggctgtggcaccagcttgcccccagggatg
ccctccagtcccaagcttctcaggcccaaaggtcagctccaaaaagaggcaccggtggga
agctgcatccctggtgacttctctctgcagggagtgagctctgtgaccatggagggactc
caggaagcagaactgttccgctcacccctgggggtctgtacggacagagaactggacctg
catgtgctacacaatggggacccagagaccctaccgtacctacaggacccgctctccctc
ctctcctctgtgcagatcgaaggccaccctgtgtctctccctttgcaccctccttccctc
tcctgctccacctccaaccaggggccacatccctggggcctgctggactcccttgtgtgt
cccaaggacgaggttcaggtatctgaggctgagcccctgagaccaggccccagggccttg
gagctcaagcagtccacagagctggactctcttttccaaggcctggccctcaccgtgcag
tgggagtcctga

KEGG   Heterocephalus glaber (naked mole rat): 101721740
Entry
101721740         CDS       T02812                                 

Gene name
Il20rb
Definition
(RefSeq) interleukin 20 receptor subunit beta
  KO
K05137  interleukin 20 receptor beta
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04061  Viral protein interaction with cytokine and cytokine receptor
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101721740 (Il20rb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101721740 (Il20rb)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101721740 (Il20rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101721740 (Il20rb)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL10/28 receptor family
   101721740 (Il20rb)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 101721740
NCBI-ProteinID: XP_012932674
LinkDB
Position
Un
AA seq 294 aa
MWLFYSLIPCLLTGEVAALPAPQNLSVHSTNMKHLLMWSPVVLAEETVYYSVEYQGEYES
LYTSHIWIPSKWCSLTEGPECDVSDDITATVPYNLRVRAILGSQTSAWSILEEPFNRNST
ILTLPGMKVSKDGFHLVIELEDLGPQFEFLVVYWRKELVTKEHDKVVRRGGIPVPLETME
PGAPYCVKAQALVKAIGRNSAFSQEECVEVQGEALPLMLALFAFVGFMLILVVVPLSIWK
MGRLLQYSCCPMVVLPDTLKITNSPQKLISCRREEVDACALEVLSSEELFRAWI
NT seq 885 nt   +upstreamnt  +downstreamnt
atgtggcttttctactccctgattccatgtttgctgacaggtgaagtagcagctctgcct
gcccctcagaacctctctgtacactcaaccaacatgaagcatctcttgatgtggagcccg
gtggtcctggctgaagaaacagtgtactattctgtcgagtaccagggggagtatgagagc
ttatacacaagccacatctggatccccagcaaatggtgctcactcactgaaggtcctgag
tgtgatgtctctgatgacatcactgccacagtcccatacaacctccgtgtcagggccatc
ttgggctcacagacttcagcctggagcatcctggaggagccctttaatcgaaactcaacc
atccttaccctgcctgggatgaaggtctccaaggacggcttccacctggttattgagctg
gaagacctgggaccccagtttgagttccttgtggtctactggaggaaggagctggtcacc
aaggaacatgacaaagtggtgaggagggggggcattcctgtgcccctcgaaaccatggag
ccaggggccccatactgcgtaaaggcccaggcgctggtgaaggccattgggaggaacagt
gccttcagccaggaagagtgtgtggaggtgcaaggagaagctcttcccctgatgctggcc
ctgtttgcctttgttggcttcatgctgatcctcgtggttgtgccactgtccatctggaag
atgggccggctgctccagtactcctgttgccccatggtggtcctcccagacaccttgaaa
ataaccaactcaccacagaagttaatcagctgcagaagggaagaggtggatgcctgtgcc
ctggaggtactgtcttctgaggagctcttccgggcgtggatctag

KEGG   Heterocephalus glaber (naked mole rat): 101722391
Entry
101722391         CDS       T02812                                 

Gene name
Ifnar2
Definition
(RefSeq) interferon alpha and beta receptor subunit 2
  KO
K05131  interferon receptor 2
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04151  PI3K-Akt signaling pathway
hgl04217  Necroptosis
hgl04380  Osteoclast differentiation
hgl04620  Toll-like receptor signaling pathway
hgl04621  NOD-like receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04650  Natural killer cell mediated cytotoxicity
hgl05160  Hepatitis C
hgl05162  Measles
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101722391 (Ifnar2)
   04151 PI3K-Akt signaling pathway
    101722391 (Ifnar2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101722391 (Ifnar2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101722391 (Ifnar2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101722391 (Ifnar2)
   04621 NOD-like receptor signaling pathway
    101722391 (Ifnar2)
   04650 Natural killer cell mediated cytotoxicity
    101722391 (Ifnar2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101722391 (Ifnar2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101722391 (Ifnar2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101722391 (Ifnar2)
   05171 Coronavirus disease - COVID-19
    101722391 (Ifnar2)
   05164 Influenza A
    101722391 (Ifnar2)
   05162 Measles
    101722391 (Ifnar2)
   05168 Herpes simplex virus 1 infection
    101722391 (Ifnar2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101722391 (Ifnar2)
   05169 Epstein-Barr virus infection
    101722391 (Ifnar2)
   05165 Human papillomavirus infection
    101722391 (Ifnar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101722391 (Ifnar2)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IFN receptor family
   101722391 (Ifnar2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 101722391
NCBI-ProteinID: XP_004842360
LinkDB
Position
Un
AA seq 551 aa
MGKGYSRKFLAQKMRCERKERTYQLTKMLLSRQTLAIRLLTLCFTVYVSLALDASHDIPE
SADENCDFKLAFRKYQLILSWELKNRSIVPTHSTFQYTIMSKKESMKTVENCTNITRSFC
DLTNVWQDMHETYIPMVEEFRGETLLVQCLGSITALNLSFEPPDFGIIGFADHINVVVQF
PPVAPTIYGEDLHDQASLIIKEHSEDIDKRHEPKISGSFSGNFSYVINNLIPNTNYCISV
YFEPRSSRTITKPPLKCVLLQPAQESGSSKSVKIVIVIVIFVSVAISIILTLRQIGYVCL
HTEFPKVLIFHNFVVRIFPELPLSEEVNILEVISINKKKKVWGYNYGDESDSEDEAPLRT
IAGGYTMHGLPGRLHSQVRTSPASSQASHLGDPADEESKEPERETQPQPQPPAAQGPSPG
QKEGTSEPSERTEGLPQDPCPKVDDGNSSGGSGDKMTFNVDLNSVFLRVLHDDEEDSEEA
ALVLPPPEEVVDLEEDPQEMESSLLVPGGEKLQVLFPNLPPECLWTGDDLSDKSDTSSSD
VDDIRDGYIMR
NT seq 1656 nt   +upstreamnt  +downstreamnt
atgggcaaggggtactccagaaaattccttgcacagaagatgagatgtgaaaggaaggaa
aggacttaccaactaacaaagatgcttttgagccgccagaccttagccatcagattgctt
accttgtgcttcacggtatatgtgagcctagcgttggatgcttcacatgatatccctgaa
tctgcagatgaaaattgtgatttcaagttggcatttcgaaaatatcagctgatcttatct
tgggagttgaaaaaccgctccattgtaccaactcactctacattccagtacacaatcatg
agtaaaaaggaaagtatgaagactgttgagaactgtacaaatatcaccagatcattttgt
gacctcaccaatgtgtggcaagacatgcatgagacctacatccccatggtggaagaattc
agaggggagacactgttggtccagtgcctgggtagcatcacggccttgaacttgtctttt
gagccaccagactttgggatcattggctttgcagaccacattaatgtggtggtgcagttt
ccacctgtggctcccacaatatatggggaggacctacacgatcaggcatcactcatcatt
aaggagcactcagaggacattgataagaggcatgaacccaaaataagtggaagctttagt
ggaaatttcagctatgtcattaacaatttaattccaaacacaaactactgcatatctgtt
tattttgagccaagaagttcaagaacaataacaaaacctcccttaaaatgtgtcctcctt
cagcctgcccaagaatcagggtcatcaaaatctgtcaaaatagtaattgttattgtgatt
tttgtgtcagtggccataagcatcatcttaacactgagacagattggatatgtatgctta
cacactgaatttcccaaagtcttgatttttcataactttgtagtccggatatttcctgaa
ctaccactgtcagaagaagtgaatatcctggaggtcatttccatcaacaaaaagaagaaa
gtgtggggttataattacggcgatgaaagtgacagcgaggatgaagcgccactcagaaca
attgccgggggttacaccatgcatggcctcccaggccggcttcacagccaggtccgaacc
tccccagcctcctcccaggcctcccacctgggggacccagccgatgaggagtccaaggag
cctgagagggagactcagccccagccccagccccctgcagcccaagggcccagcccaggg
cagaaggaaggcacaagtgaacccagtgagaggacagaaggtctgccccaggacccctgt
cccaaggttgacgacggcaactcctctgggggatctggggataaaatgaccttcaatgtg
gatttgaattctgtgtttttgagagttctccatgatgacgaagaagactccgaagaagct
gccctggtgttacctcctccagaagaggttgtcgacctggaagaggatccccaggagatg
gaatccagccttctagtgcctggtggggaaaagctacaggtgttgtttcccaacctccct
cccgagtgcctctggactggagatgatctctctgataaaagtgacaccagtagttctgac
gtggacgatatcagggatggttatatcatgagatga

KEGG   Heterocephalus glaber (naked mole rat): 101723546
Entry
101723546         CDS       T02812                                 

Gene name
Il10rb
Definition
(RefSeq) interleukin 10 receptor subunit beta
  KO
K05135  interleukin 10 receptor beta
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04061  Viral protein interaction with cytokine and cytokine receptor
hgl04630  JAK-STAT signaling pathway
hgl05145  Toxoplasmosis
hgl05152  Tuberculosis
hgl05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101723546 (Il10rb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101723546 (Il10rb)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101723546 (Il10rb)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101723546 (Il10rb)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101723546 (Il10rb)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101723546 (Il10rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101723546 (Il10rb)
   04090 CD molecules [BR:hgl04090]
    101723546 (Il10rb)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL10/28 receptor family
   101723546 (Il10rb)
CD molecules [BR:hgl04090]
 Proteins
  101723546 (Il10rb)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 DUF3899 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 101723546
NCBI-ProteinID: XP_004842363
LinkDB
Position
Un
AA seq 374 aa
MARILACWLGGCLLASALGMVPPPQNVRMNSVNFKNILQWDSPAFPKGNLTFTAQYHSYK
KFQEVCKSTASTECDFSNLSKYGDHTLRVRAELAEEHSDWVNITFCPVDDTVIGPPVVHV
EALADSLQMRLLAPQIENEPYTWTMRKIYDSWVYNVQFWKNGTDEKFAVTVQYDFELVRN
LEPWTTYCVRVRGFLPDRNKTGEWSEPVCERTAEDETTPSWLVACILIVSVFVALLVLLG
CFTLLWYVYKKTKYTFSPGSSLPQHLKEFLGHPHHGTLLVFSFPLSGESDVFDKLSVITE
YSENSRQNPDDSCSLEAPSGPGPPELLSEEEPYSVGPSDPALPESASERDQHNLLSKHQI
YNSQTVDLSKQPKN
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggcgcggatcctcgcgtgctggctgggcggttgcctgctggcgtcagcactggggatg
gtgccacctcctcaaaatgtcagaatgaattcagttaatttcaagaacattctacagtgg
gactcgcctgcatttcccaaagggaacctgacattcacagctcagtaccatagttataag
aaattccaagaagtatgcaagagcactgcctccacagaatgtgatttctcaaatctttcc
aagtatggcgaccacaccttgagagtcagggcagagcttgcagaggagcattcggactgg
gtgaacatcactttctgtcccgtggatgacaccgttattggacctcctgtagtacatgta
gaagcacttgctgattctttacagatgcgtctcttagcccctcaaattgagaatgaacct
tacacatggaccatgaggaagatttatgactcgtgggtttataatgtgcagttctggaaa
aatggcactgatgaaaagtttgctgtcactgttcagtacgactttgagctcgtccggaac
ctggagccatggacaacttactgcgttcgggttcgagggtttcttcctgatcggaacaaa
actggggaatggagtgagcctgtgtgtgagcgcacagccgaggacgaaacgaccccctcc
tggctggtggcttgcatcctcatagtctcggtctttgtggccttgctcgtgctcctggga
tgcttcaccttgctgtggtatgtctacaagaagaccaagtacaccttctcacccgggagt
tctcttccgcagcacctgaaagagtttttgggccacccacatcacgggacacttctggtt
ttctccttcccactctccggtgagagtgacgttttcgacaagctaagtgtcattacagaa
tactctgaaaacagcaggcagaatcctgatgacagttgcagccttgaggccccgtctgga
ccaggacccccagagctactttccgaggaggaaccctactcagtgggacccagcgaccct
gctctccccgagtctgcctcagagagagatcagcacaacctcctgagcaaacaccagatc
tacaactctcagacagtggacttgtccaaacaaccaaagaactag

KEGG   Heterocephalus glaber (naked mole rat): 101723599
Entry
101723599         CDS       T02812                                 

Gene name
Csf3r
Definition
(RefSeq) colony stimulating factor 3 receptor
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04151  PI3K-Akt signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04640  Hematopoietic cell lineage
hgl05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101723599 (Csf3r)
   04151 PI3K-Akt signaling pathway
    101723599 (Csf3r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101723599 (Csf3r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101723599 (Csf3r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101723599 (Csf3r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101723599 (Csf3r)
   04090 CD molecules [BR:hgl04090]
    101723599 (Csf3r)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  Prolactin receptor family
   101723599 (Csf3r)
CD molecules [BR:hgl04090]
 Proteins
  101723599 (Csf3r)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 IL6Ra-bind EpoR_lig-bind fn3_2 ObR_Ig
Other DBs
NCBI-GeneID: 101723599
NCBI-ProteinID: XP_004851024
LinkDB
Position
Un
AA seq 843 aa
MAGLGACSLTRAALIILFLPRSLENCGHISISAHVMRLGDPVTASCTVTQSCSHLDPEPQ
ILWKLGAELLQHRGRQQSHPDGSQKSTITLPHLNSTHTFLLCYLNWSNSLQLLDQAELWA
GYPPAMPSNLSCLMNLTSNSLICQWEPGPDTHLPTNFTLKSFKSRGDCQTQEDPIKDCVP
AAGQSSCSIPRKHLLLYQNMVIWVQAENALGTSLSPQLCLDPMDVVKLEPPTLMALDPNP
EMALPQPDCLWLRWEPWKPSIYMDQKCELRYRPQLREASWAQVAPLPSSTTRYELCGLRP
ATTYALQMRCIRWPLPGHWSTWSPSLELQTTQGAPIVRLDTWWRQRQLDPKTKQVQLFWK
PTPLEEDSGQIQGYLLSWSTPGHAGPVLLLCNTTELSCTFQLPSGAGEVTLVAYNRAGTS
HPTPVVFLESKGPALARLHAMARDPQCLWVCWEAPSPVPQGYVIEWGLSPPSPSSTNMTW
RLEPNGSITETLLQENIRPFQLYEITVTPLYQSTMGHPKNVYVYSQEMAPPRTPVLHLKH
IGKTWAQLEWVPEPSELGKSPLTHYTVFCTNMQDQSFSTILNASFHGFVLHGLKPSTLYH
VHLMATSQAGATNSTSLTLMTLAQGESELHIFLGVFGILVLLILLCGTAWLCCSPSRKNP
LWPNVPDPAHSSLGSWVSTTMAEETFQLPSLRDPSMTSITKITVLEEEEKKQLGPWESSD
SSETCGLPTLVQAYVLQKDPRAASTQSQPQPGASDQVFYGQVLGSSTTPGPGPYIRCDST
QPLLGGLTPSPKSYENLWFQTSPLRMPVSPSQNQEDDCVFGPLLDFPLLQGLRVHGVEGL
AGF
NT seq 2532 nt   +upstreamnt  +downstreamnt
atggcagggctgggagcctgcagcctgaccagagcagccttgatcatcctcttccttccc
agaagcttggagaactgcggacacatcagcatctccgctcatgtcatgcgcctgggggac
cctgtcacagcctcctgcactgtcacccagagctgcagccacctggatccagagccacag
atcctatggaagctgggagcagagctgctgcagcacagggggaggcagcagagccaccct
gatgggtcccagaaatcgaccatcaccctgccacacctcaacagcactcacacctttctc
ctctgctacctgaactggagcaacagcctgcaactcctggaccaagctgagctgtgggca
ggctaccctccagccatgccctctaacctgtcctgcctcatgaacctcacgagcaacagc
ctcatctgccagtgggagccaggacctgacacccacctgcccactaacttcaccctgaaa
agcttcaagagccggggcgactgccagacccaggaggaccccatcaaggactgcgtgcct
gctgccgggcagagctcctgctccatcccacgcaagcacctgctcttgtaccagaacatg
gtcatctgggtgcaggcagagaatgcgctggggaccagcctgtccccacagctgtgcctt
gaccccatggacgttgtaaaactggagccccccacactgatggccctggaccccaatcct
gagatggccctaccccagccagactgcctgtggttgcgctgggagccatggaagcccagc
atttacatggaccagaagtgtgagctgcgctaccggccacagctaagagaagccagctgg
gcacaggtggcccccctgccctccagcaccacccggtacgagctctgtgggctccgtcca
gccacaacctatgccctgcagatgcgctgcatccgctggcccttgcctggccactggagc
acctggagccccagcctggagcttcaaaccacccaaggggcccccatcgtcagactggac
acgtggtggcggcaaaggcagctggatcccaaaaccaagcaggtgcagctgttctggaag
cccacacccctggaggaagacagcggacagatccaagggtacctgctctcctggagcacc
ccaggccacgccgggccagtcttgctcctctgcaacaccacagagctgagctgcaccttc
cagctgccttctggggccggggaggtgactcttgtggcctacaacagagctgggacctct
catcccaccccagtggtctttctggagagcaaaggcccagccctggccagactccatgcc
atggcccgagaccctcagtgcctctgggtgtgctgggaggcccccagccctgtccctcag
ggctatgtgattgaatggggcctgagtccccccagccccagcagcaccaacatgacctgg
aggctggaacccaatgggagcatcacggagactctgctgcaggagaacatcaggcccttt
cagctctacgagatcactgtgactcccctgtatcagagcaccatgggacaccccaagaac
gtctatgtctactcccaagaaatggcccctccccgcaccccagtgctgcatctaaagcac
attggtaagacctgggctcagctggagtgggtgccggagccctctgagctggggaagagc
ccccttacccactacaccgtcttctgcaccaacatgcaggaccaatccttctccaccatc
ctgaacgcctccttccatggctttgttctgcacggcctgaagccctccaccctgtaccat
gtccacctcatggccaccagccaggccggggccaccaatagtacaagcctcaccctgatg
accttggcccaaggagagtctgagctacacatcttcctgggcgtgtttggcatcctggtt
ttgctcatccttctctgtgggactgcctggctctgctgcagccccagcaggaagaatcca
ctgtggccaaacgtgccagacccggcccacagcagcctgggctcctgggtgtccaccacc
atggcagaggagaccttccagctgcccagccttcgggaccccagcatgacatccatcacc
aagatcaccgtgctggaggaggaggagaagaagcagctagggccctgggagtccagtgac
agctcggagacctgtggcctccctaccctcgtccaggcctatgtgctccagaaagaccca
agagcagcttccacccagtcacagccacagcctggcgccagtgaccaggtcttttacggg
caggtgctgggcagctccaccactccagggccagggccctacattcgctgtgactctact
cagcccctcttggggggcctcacccccagtcctaaatcctatgagaatctttggttccaa
accagtcccctgaggatgccagtgtcgccatcccaaaaccaggaggatgactgtgtcttt
gggccactgcttgacttccccctcctgcaagggctccgtgtccatggagtggagggactc
gcaggcttctag

KEGG   Heterocephalus glaber (naked mole rat): 101723721
Entry
101723721         CDS       T02812                                 

Gene name
Il13ra1
Definition
(RefSeq) interleukin 13 receptor subunit alpha 1
  KO
K05076  interleukin 13 receptor alpha-1
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
hgl05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101723721 (Il13ra1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101723721 (Il13ra1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101723721 (Il13ra1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101723721 (Il13ra1)
   04090 CD molecules [BR:hgl04090]
    101723721 (Il13ra1)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL3 receptor family
   101723721 (Il13ra1)
CD molecules [BR:hgl04090]
 Proteins
  101723721 (Il13ra1)
SSDB
Motif
Pfam: Il13Ra_Ig IL6Ra-bind fn3 EpoR_lig-bind LIFR_D2
Other DBs
NCBI-GeneID: 101723721
NCBI-ProteinID: XP_004872202
LinkDB
Position
Un
AA seq 425 aa
MELSAGLCGLWALLLCAGADRVAAPPKTQPPVTNLSVSVENLCTVIWTWNPPEGASPNCS
LRYFSHFDDQQEKKIAPETHRSKEVPLNEKICLQVGSQCSMNESEKRSILLEKCISPLAG
DPESAVTELQCIWHNLGFMNCSWLPGKNSSPDTNYTLYYWHSSLGKILQCENIYKEGQYI
GCSFDLSKVKDSSFEQYSVQVMVKDNAGKIRPSFHIVPLRSRVKPDPPHIKNLSFREGTL
YVHWENPPNFDSRCLSYEVEVNKSQTETHGIFSADEDGCQNSVFERNMTGTTCFMVPGVL
PDTFYTVRIRVKTNKLCYEDDKLWSNWSQVMNIGKKPNSIFYMTMLLIIPVIVAGVIIVL
LLYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYDIYEKQSKEETDSVVLIENLK
KALND
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggagctgtcggcggggctctgcgggctgtgggcgctgctgctctgcgccggcgccgac
agggtcgccgcgcccccaaaaactcagccacctgtgacgaatttgagtgtctcagttgaa
aacctctgcacggtgatatggacatggaatcctcctgagggagccagcccaaattgtagc
ctaaggtattttagtcattttgatgaccagcaggagaagaaaattgctccagaaactcat
cgttcaaaggaagttcccctaaatgagaagatttgtctgcaagtgggatcccagtgtagc
atgaatgaaagtgagaagcgtagcattttgctagaaaagtgcatctcacccctggcaggt
gatccagagtctgctgtgactgagcttcagtgtatctggcacaacctggggttcatgaac
tgttcttggctccctggaaagaattcaagtcctgacactaactatactctttactactgg
cacagcagcctgggaaaaattcttcaatgtgaaaacatctataaagaaggtcaatacatt
ggttgttcctttgatctgagtaaagtgaaggattccagttttgaacaatacagtgtccaa
gtaatggtcaaggataatgcaggaaaaattaggccatccttccatatagtgcctttaaga
tcccgtgtgaaacctgatcctccacatattaaaaatctctcattcagagaaggtacctta
tatgtgcattgggagaatccaccaaattttgatagcagatgcttatcttatgaagtagaa
gtcaataagagccaaactgagacacatggtattttttccgctgatgaggatggatgtcag
aattcagtgtttgaaagaaacatgacgggtacaacttgttttatggtccctggtgttctt
cctgatactttttacacagttagaataagagtcaagacaaataaactttgctatgaagat
gacaaactctggagtaattggagtcaagtgatgaatataggtaaaaagcccaattccata
ttctacatgaccatgttactcatcattccggtcatcgttgcgggtgtgattattgtcctt
ctgctttacctaaaacggctcaagatcattatattccctccaattcctgatcctggcaag
atttttaaagaaatgtttggagaccagaatgatgataccctgcactggaagaagtatgac
atctatgagaagcaatccaaagaagaaactgactctgtagtgctgatagaaaacctgaaa
aaagctctcaatgattag

KEGG   Heterocephalus glaber (naked mole rat): 101723734
Entry
101723734         CDS       T02812                                 

Gene name
Il9r
Definition
(RefSeq) interleukin 9 receptor
  KO
K05073  interleukin 9 receptor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
hgl04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101723734 (Il9r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101723734 (Il9r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101723734 (Il9r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101723734 (Il9r)
   04090 CD molecules [BR:hgl04090]
    101723734 (Il9r)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL2 receptor family
   101723734 (Il9r)
CD molecules [BR:hgl04090]
 Proteins
  101723734 (Il9r)
SSDB
Other DBs
NCBI-GeneID: 101723734
NCBI-ProteinID: XP_004873935
LinkDB
Position
Un
AA seq 489 aa
MALGRSIWEGWTLESEALIQDVGTWLLLCTCVCWGVSVPEEGGETRAETFTCLTNYILRI
DCHWSAPELGQGCGPWLLFTSNQAPGSKHKCIFQGSSCTVVLPPEEVLLPSDNFTIIFHY
CVSGKEQVSLVDSEYLPRRHVKLDPPSDLQSNTSSGSCVLTWSISPALEPMAALLSYELA
FKKQEEAWERAQHKDHIVGVTLLTLEAVELDPGSTYEARLRVQMAMQEEDMAEEECHEGQ
WSKWSQPVCFFSPQPHGLLISSEKWPETALVAVTIFLLLTGLTYLLFKLSSRMKRTFYQN
VPSPVAFFQPLYTEHGGNFQTWTEAHRAGPQPTQDCDSIPQGASESGVWEAIALLTYGPA
WPWQPSGLEGKENPGSGLPKSWSLEDVLPAGCVELEGQPSPYLPQEDWAPMSSTRPASPD
SEGGSGDYCVLDCYGGCHPSALPGNTQSPMPLPALACGLSWVQQGLDAQQRGACEGAAHS
QGHGLPEDL
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggcactaggcagatccatctgggaaggttggaccttggagagtgaggccctgattcaa
gatgtgggcacctggctcctgctctgtacctgtgtctgctggggagtctctgtcccagag
gagggaggagagacaagggctgaaactttcacctgcctcaccaactacatcctcaggatt
gattgccattggtctgccccagagttgggccagggctgtggcccctggctcctcttcacc
agcaaccaggcacctggcagcaagcacaagtgcatcttccagggtagttcatgcactgtg
gtgctgccgcccgaggaggtgctcctgccttctgacaacttcaccatcattttccactac
tgtgtctctgggaaggagcaggttagcctggtggactcggagtacctgccccggagacat
gttaagctggatcctccctctgacttgcagagcaacaccagctctggctcctgtgtcctg
acctggagcatcagtcctgccctggagccgatggccgcacttctcagctatgagctggcc
ttcaagaagcaggaagaggcctgggagcgggcccagcacaaggaccacatagttggggtg
accttgcttacccttgaagccgttgagttggaccctggctccacttatgaggccaggctg
cgtgtccagatggccatgcaggaagaggacatggcagaggaggagtgtcatgagggccag
tggagcaagtggagccagcctgtgtgcttcttctctccccaaccacatggcctcttgatt
tcatctgagaagtggccagagaccgcccttgttgctgtgaccatctttcttctgctgact
ggcctgacctacctcctgttcaagctgtcatccaggatgaagagaactttctaccagaac
gtgccctcgccagtggcattcttccagcccctctacactgagcacggtgggaacttccag
acctggacagaggcccacagggctggtccacaaccaacccaagactgcgatagcattcca
caaggagcctcagaatccggtgtgtgggaggccatcgcactgctcacttacggcccagca
tggccctggcagccctcaggcctggagggcaaagagaatcctggctctggcctcccaaaa
tcctggagcttagaggatgtgctgccagcagggtgtgtggaattggaaggacagccatct
ccctatctgccacaggaggactgggcccccatgtcctccaccagaccagcttccccagac
tcagagggtggcagcggtgactactgtgtcctggattgctatgggggttgccacccctca
gccctcccaggaaacacgcagagtcccatgcccctcccggccttggcctgtggcctttcc
tgggtccagcagggtttggatgcccagcagagaggtgcctgtgagggagctgctcacagt
cagggtcatgggctgcctgaggacctctag

KEGG   Heterocephalus glaber (naked mole rat): 101723771
Entry
101723771         CDS       T02812                                 

Gene name
Egfr
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl04010  MAPK signaling pathway
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04020  Calcium signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04068  FoxO signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04144  Endocytosis
hgl04151  PI3K-Akt signaling pathway
hgl04510  Focal adhesion
hgl04520  Adherens junction
hgl04540  Gap junction
hgl04630  JAK-STAT signaling pathway
hgl04810  Regulation of actin cytoskeleton
hgl04912  GnRH signaling pathway
hgl04915  Estrogen signaling pathway
hgl04921  Oxytocin signaling pathway
hgl04926  Relaxin signaling pathway
hgl04928  Parathyroid hormone synthesis, secretion and action
hgl04934  Cushing syndrome
hgl05160  Hepatitis C
hgl05163  Human cytomegalovirus infection
hgl05165  Human papillomavirus infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05219  Bladder cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05230  Central carbon metabolism in cancer
hgl05231  Choline metabolism in cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101723771 (Egfr)
   04012 ErbB signaling pathway
    101723771 (Egfr)
   04014 Ras signaling pathway
    101723771 (Egfr)
   04015 Rap1 signaling pathway
    101723771 (Egfr)
   04630 JAK-STAT signaling pathway
    101723771 (Egfr)
   04066 HIF-1 signaling pathway
    101723771 (Egfr)
   04068 FoxO signaling pathway
    101723771 (Egfr)
   04020 Calcium signaling pathway
    101723771 (Egfr)
   04072 Phospholipase D signaling pathway
    101723771 (Egfr)
   04151 PI3K-Akt signaling pathway
    101723771 (Egfr)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101723771 (Egfr)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101723771 (Egfr)
   04520 Adherens junction
    101723771 (Egfr)
   04540 Gap junction
    101723771 (Egfr)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101723771 (Egfr)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101723771 (Egfr)
   04915 Estrogen signaling pathway
    101723771 (Egfr)
   04921 Oxytocin signaling pathway
    101723771 (Egfr)
   04926 Relaxin signaling pathway
    101723771 (Egfr)
   04928 Parathyroid hormone synthesis, secretion and action
    101723771 (Egfr)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101723771 (Egfr)
   05206 MicroRNAs in cancer
    101723771 (Egfr)
   05205 Proteoglycans in cancer
    101723771 (Egfr)
   05230 Central carbon metabolism in cancer
    101723771 (Egfr)
   05231 Choline metabolism in cancer
    101723771 (Egfr)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101723771 (Egfr)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101723771 (Egfr)
   05212 Pancreatic cancer
    101723771 (Egfr)
   05225 Hepatocellular carcinoma
    101723771 (Egfr)
   05226 Gastric cancer
    101723771 (Egfr)
   05214 Glioma
    101723771 (Egfr)
   05218 Melanoma
    101723771 (Egfr)
   05219 Bladder cancer
    101723771 (Egfr)
   05215 Prostate cancer
    101723771 (Egfr)
   05213 Endometrial cancer
    101723771 (Egfr)
   05224 Breast cancer
    101723771 (Egfr)
   05223 Non-small cell lung cancer
    101723771 (Egfr)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101723771 (Egfr)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101723771 (Egfr)
   05171 Coronavirus disease - COVID-19
    101723771 (Egfr)
   05163 Human cytomegalovirus infection
    101723771 (Egfr)
   05165 Human papillomavirus infection
    101723771 (Egfr)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101723771 (Egfr)
   01522 Endocrine resistance
    101723771 (Egfr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101723771 (Egfr)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hgl04147]
    101723771 (Egfr)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101723771 (Egfr)
Protein kinases [BR:hgl01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   101723771 (Egfr)
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101723771 (Egfr)
  Exosomal proteins of pancreatic cancer cells
   101723771 (Egfr)
  Exosomal proteins of bladder cancer cells
   101723771 (Egfr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH Kdo
Other DBs
NCBI-GeneID: 101723771
NCBI-ProteinID: XP_004839898
LinkDB
Position
Un
AA seq 1211 aa
MRPCGVAGPALCALLALVGASAAPEEKRVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVV
LGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTAERIPLENLQIVRGNVLYENTYALAV
LSNYGGTNSANRTGLRELPLRSLQEILQGTVRFSNNPVLCSVDTIQWRDIMDSRFLSNMS
LDLQSHQSSCQKCDPSCPNGSCWAPGEENCQKLTRIICAQQCSGRCRGKSPSDCCHNQCA
AGCTGPRESDCLVCQKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPR
NYVVTDHGSCVRACGPDSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIK
HFRNCTAISGDLHILPVAFRGDSFTRTPPLDPKELDILKTVKEITGFLLIQAWPENRTDL
HAFENLEIIRGRTKQHGQFSLAVVGLNLTSLGLRSLKEISDGDVIVSGNRHLCYANTINW
RKLFGTSGQKTKIINNRGEKACTTDGHICHPLCSAEGCWGPQPWDCVSCRNVSRGRECVA
TCNVLEGEPREFVENSECIQCHPECLPQAMNVTCTGRGPDSCIQCAHYIDGPHCVKTCPA
GIMGENNTLVWKYADSSHVCRLCHPNCTYGCAGPGLEGCPIKGPRIPSIATGIVGGLFLL
VVLALGVGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKAKV
LGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRL
LGICLTSTVQLVTQLMPFGCLLDYVREHKDNIGSQHLLNWCVQIAKGMNYLEDRRLVHRD
LAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDV
WSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADS
RPKFRELIVEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYL
IPQQGFFSSPSTSRTPLLSSLSANSNNSTGACVHRNGQSCPAQGDNFLQRYSSDPTGAPA
EDSLDAEFLPAPEYINQSFSRRPAGSMQNPMYHNQPEHPAPGRDPHYLNPHSYAVGNPEY
LNTLLRTCVSDSDGSIPWTQKGNHQISLDNPDYQQDFFPKEAKPNGIFKGPTAENAEYLR
VAPPSSEFIGA
NT seq 3636 nt   +upstreamnt  +downstreamnt
atgcggccgtgcggggtggcggggccggcgctgtgcgcgttgctggcgctggtcggggcg
agtgcggcgcccgaagagaagcgcgtttgccaaggcacaagtaacaagctcacccagctg
ggcacctttgaggaccactttctgagcctccagcgcatgttcaacaactgtgaggtggtg
ctcgggaacctggagatcacctatgtgcaaaggaattacgacctttccttcctgaagacc
atccaggaggtggctggctatgtgctcattgctctcaacacggcagagaggatcccgctg
gagaacctgcagattgtgcgtgggaatgtgctctacgaaaacacctacgcccttgccgtc
ctgtctaattatgggggcaccaacagtgccaaccggaccgggcttcgggagctgccactg
aggagcctgcaggagatcctgcagggcaccgtgcgctttagcaacaaccccgtgctctgc
agcgtggacaccatccagtggagggacatcatggatagcagattcctgagcaacatgtca
ctggacctgcagagccaccagagcagctgccaaaagtgtgatccaagctgtcccaacggg
agctgctgggccccaggagaggaaaactgccagaaattgaccaggatcatctgtgcccag
cagtgctcggggcgctgccgaggcaagtcccccagcgactgctgccataaccagtgtgcg
gccggctgcacaggaccccgggagagtgactgcctggtctgccaaaagttccgcgacgaa
gccacctgcaaggacacctgcccgccgctcatgctctacaaccccaccacgtaccagatg
gatgtcaaccccgaggggaagtacagctttggcgccacctgcgtgaagaagtgtccccgg
aactacgtggtgacagaccatggctcctgtgtccgggcctgcggccccgacagctacgag
atggaggaggacggcgtccggaagtgcaagaagtgcgaaggcccctgccgcaaagtttgc
aacggaatagggatcggggaattcaaagacacgctttccataaatgccacaaacatcaag
cacttccggaactgcacagccataagcggcgacctgcacatcctcccggtggccttccgg
ggggactccttcacgcgcacgccgcccctggaccccaaggagctggacatcctgaagaca
gtgaaggagatcacagggttcttgctgattcaggcctggcctgagaacaggaccgacctc
cacgcctttgagaacctggaaatcatccgcggcaggacaaagcaacatggccagttttct
ctcgctgtcgttggcctgaacctgacgtccctggggctgcgctccctgaaggagatcagt
gatggggacgtgattgtctctggaaaccgacacctatgctatgccaacaccatcaactgg
agaaagctgtttgggacttccggtcagaaaaccaagattatcaacaacagaggcgagaag
gcctgcaccactgatggccacatctgccacccgctgtgctcagctgagggctgctggggt
ccccagccctgggactgcgtctcctgccggaacgtgagccggggcagagagtgcgtggcc
acgtgcaacgtcctggagggggagccccgggagttcgtggagaattctgagtgcatccag
tgccaccccgagtgcctgccccaggccatgaacgtgacctgcaccggcaggggccctgac
agctgcatccagtgtgcacactacatcgatggcccccactgtgtcaagacctgcccagcc
gggatcatgggggagaacaacacgctggtgtggaagtacgcggacagcagccacgtgtgc
cgcctgtgccaccccaactgcacctacggatgtgccgggccaggtctggaaggctgtcca
ataaaagggcccaggatcccctccatcgccactgggattgtgggcggcctcttcctgctg
gtggtgctggccctgggcgtcggcctcttcatgcggaggcgccacattgtccgcaagcgc
acactgcgccggctgctgcaggagcgtgagctggtggagcccctcacacccagtggagag
gcccccaaccaggccctgctgcggatcctaaaggagacagaattcaagaaggccaaggtg
ctaggctccggagcatttggcaccgtctacaagggactgtggatcccagaaggcgagaaa
gtgaagatccctgtggccatcaaggaattgcgagaagccacatccccgaaagccaacaag
gagatcctggacgaagcctatgtgatggccagcgtggacaacccccacgtgtgccgactg
ctgggcatctgcctaacctccaccgtgcagctggtcacacagctcatgcccttcggctgc
ctgctggactacgtgcgtgagcacaaggacaacatcgggtctcagcacctcctcaactgg
tgtgtgcagatcgccaagggcatgaactacctggaggaccggcgcctggtgcaccgggac
ctggcggccaggaacgtcctggtgaagacaccacagcatgtgaagatcacagacttcggg
ctggccaagctgctgggcgcggaggagaaggagtaccacgctgagggcggcaaggtgccc
atcaagtggatggctttggaatcgattttacaccgcatttatacccaccagagtgacgtc
tggagctatggagtcacagtgtgggagctgatgacctttgggtccaagccatatgacggg
atccctgcaagcgagatctcgtccatcctggagaaaggagagcgcctcccgcagccgccc
atctgcaccatcgacgtctacatgatcatggtcaagtgctggatgatagatgcagacagt
cgcccgaagttccgcgagttaatcgttgagttctccaaaatggcccgagacccccagcgc
taccttgtcattcagggggatgaaaggatgcatctgccaagccctacggactccaacttc
taccgtgccctgatggacgaggaggacatggaggatgtcgtagatgcagacgaatacctc
attccacagcagggcttcttcagcagcccctccacctcccggactccactcctgagttct
ctgagtgcaaacagcaacaactccacgggagcttgtgttcacagaaacgggcagagctgc
cctgcccagggagacaacttcctgcagcgctacagctcggaccccacgggcgccccagcc
gaggatagcctggatgccgagttcctcccagcacccgaatacataaaccagtccttctcc
agaaggcctgcaggctccatgcagaaccccatgtatcacaatcagcccgagcaccccgct
cctggcagagacccacactacctaaacccccacagctatgccgtgggcaaccctgagtat
ctcaacaccctcctgcggacctgtgtcagcgactcagacggctccatcccctggacccag
aagggcaaccaccaaattagcctggacaaccctgactaccagcaggacttcttccccaag
gaagccaagcccaacggcatctttaagggccccacagcggaaaatgcagaataccttcgg
gtggccccgccaagcagtgagtttattggagcgtga

KEGG   Heterocephalus glaber (naked mole rat): 101724158
Entry
101724158         CDS       T02812                                 

Gene name
Ifnar1
Definition
(RefSeq) interferon alpha and beta receptor subunit 1
  KO
K05130  interferon receptor 1
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04151  PI3K-Akt signaling pathway
hgl04217  Necroptosis
hgl04380  Osteoclast differentiation
hgl04620  Toll-like receptor signaling pathway
hgl04621  NOD-like receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04650  Natural killer cell mediated cytotoxicity
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101724158 (Ifnar1)
   04151 PI3K-Akt signaling pathway
    101724158 (Ifnar1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101724158 (Ifnar1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101724158 (Ifnar1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101724158 (Ifnar1)
   04621 NOD-like receptor signaling pathway
    101724158 (Ifnar1)
   04650 Natural killer cell mediated cytotoxicity
    101724158 (Ifnar1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101724158 (Ifnar1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101724158 (Ifnar1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101724158 (Ifnar1)
   05160 Hepatitis C
    101724158 (Ifnar1)
   05171 Coronavirus disease - COVID-19
    101724158 (Ifnar1)
   05164 Influenza A
    101724158 (Ifnar1)
   05162 Measles
    101724158 (Ifnar1)
   05168 Herpes simplex virus 1 infection
    101724158 (Ifnar1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101724158 (Ifnar1)
   05169 Epstein-Barr virus infection
    101724158 (Ifnar1)
   05165 Human papillomavirus infection
    101724158 (Ifnar1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101724158 (Ifnar1)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IFN receptor family
   101724158 (Ifnar1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 101724158
NCBI-ProteinID: XP_004842365
LinkDB
Position
Un
AA seq 569 aa
MLGTAAAWAMLALLGPTALTLVAGASWGSPAASGGKSLKPPENVEVSIIDDDFTLKWNRR
HESVRNVTFSADYITSEMDNWIKLPGCQHITGSKCSFSLLDINFYENITLRIRAEEENST
SSWYYVDSFIPFEKARLGPPEVHLEAEDKAIIIYFFRPGKKDDSSIWGMDTTGFSFSLVF
WENSSQVEKQIKTNHYTYKIYNLSPETTYCLKAKARLLLQNRSGVCGPVYCINTTVEHKP
PAPENVEVVTQNQSYVLKWDYEDRNVTFRAQWLYAFSKLIPGDNSDKWKQIPNCENVRTT
YCVFPQNTFLKGSCVLRVQASDGNNTSFWSKEKNINTEMYYAIFPPDISVKSTSDSMRVF
VTALKDPWNKFYPFIYEVIFWENTSNTERKIVAKEIDLTIPDLQPLRLYCVKARWHLLQD
KWNKTSAFSAVVCEKTKPGASSTTWVVIGIFALLVIVICVVKILQRCLKYVFFPALKPPC
SIDENFSEHSFGNLLLSTSEEQTEKCFIIENTQSVIIVEETDEIDEDCKKYDSQTSQDSG
NYSNEDETLESQISEVLLQQEVLSPGPIS
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgttagggacggcggccgcctgggcgatgctcgccttgctgggccccacggccctgacg
ctggtggccggggcgtcgtgggggtcacccgcagcctcaggtggaaaaagtctaaaacct
cctgagaatgtagaggtgtccatcatagatgatgactttaccctgaagtggaacagaagg
catgaatctgtcaggaatgtgactttttcagcagattatataacatctgagatggataat
tggataaaattgcctgggtgtcaacatatcacaggttcaaaatgcagcttctctttgctt
gacataaatttttatgaaaacattactttgcgtataagagcagaagaagaaaacagcact
tcttcgtggtattacgttgactcatttataccatttgagaaagctcgccttggtcctccg
gaagtacatttagaagctgaagataaagcaataataatatacttcttccgtcctggaaaa
aaagatgacagttctatatggggtatggatactacaggcttttcattcagcttagttttc
tgggaaaactcttcacaagtggaaaaacagatcaaaaccaatcattacacgtataaaatt
tataacctctcaccagagacaacatattgtttaaaagctaaagcaagactacttttgcag
aatagatctggtgtctgtggcccggtatattgtataaataccacagttgaacataagcca
cctgcaccagaaaatgtagaagttgttactcagaatcagagctatgttctgaagtgggat
tatgaagatagaaatgtgacctttcgagctcagtggctctatgctttttcaaaactgatt
cctggggacaactcagataaatggaaacaaatacctaactgtgaaaatgtcagaactaca
tattgtgtatttcctcaaaatactttcctaaaaggaagttgcgttctccgtgtacaagca
tcggatggaaacaacacatctttttggtctaaggagaaaaacattaatactgaaatgtac
tatgccatatttcctccagacatttctgtgaaatccactagtgattcaatgcgggtcttt
gtcacagctctgaaagatccctggaacaaattttaccccttcatttatgaagttattttt
tgggaaaacacttcaaatactgagagaaaaattgtagcaaaggaaattgaccttactatc
cctgacttgcaaccactgaggctatattgtgtcaaagccaggtggcaccttctgcaggac
aagtggaataaaaccagtgctttcagtgctgtggtgtgtgagaaaacaaagccaggagct
tcttctactacatgggtagtaattggaattttcgccctactagtcatagtcatttgtgtt
gtgaaaatccttcagagatgtctcaagtatgtgtttttcccggcacttaaacctccttgc
agtattgatgagaatttctctgaacattcatttgggaatcttctactttccacttctgag
gaacaaacggaaaaatgtttcataattgaaaacacacaaagtgttatcatagtagaggag
actgatgaaattgatgaagactgtaagaagtacgattcccagaccagtcaagattcagga
aactactctaatgaagatgagactctggaaagtcaaataagcgaagtgcttctacagcag
gaagtcctatctccaggaccaatctcctga

KEGG   Heterocephalus glaber (naked mole rat): 101724858
Entry
101724858         CDS       T02812                                 

Gene name
Ifngr2
Definition
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04066  HIF-1 signaling pathway
hgl04217  Necroptosis
hgl04380  Osteoclast differentiation
hgl04630  JAK-STAT signaling pathway
hgl04650  Natural killer cell mediated cytotoxicity
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl05140  Leishmaniasis
hgl05142  Chagas disease
hgl05145  Toxoplasmosis
hgl05152  Tuberculosis
hgl05164  Influenza A
hgl05168  Herpes simplex virus 1 infection
hgl05200  Pathways in cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hgl05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101724858 (Ifngr2)
   04066 HIF-1 signaling pathway
    101724858 (Ifngr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101724858 (Ifngr2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101724858 (Ifngr2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101724858 (Ifngr2)
   04658 Th1 and Th2 cell differentiation
    101724858 (Ifngr2)
   04659 Th17 cell differentiation
    101724858 (Ifngr2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101724858 (Ifngr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101724858 (Ifngr2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101724858 (Ifngr2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101724858 (Ifngr2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101724858 (Ifngr2)
  09172 Infectious disease: viral
   05164 Influenza A
    101724858 (Ifngr2)
   05168 Herpes simplex virus 1 infection
    101724858 (Ifngr2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101724858 (Ifngr2)
   05140 Leishmaniasis
    101724858 (Ifngr2)
   05142 Chagas disease
    101724858 (Ifngr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101724858 (Ifngr2)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IFN receptor family
   101724858 (Ifngr2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3 SusE Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 101724858
NCBI-ProteinID: XP_004842367
UniProt: A0A0N8ESV1
LinkDB
Position
Un
AA seq 349 aa
MRPPAPGLWLLLSLCCLGTAATPSDSSQLAAPRNPKIHLYNAEQILRWEPSSPGNDTVPV
TYRVQFKYTGSNWSDFESPEVNCTQISATECKFATATLSEGFPKDFNVSLRVRAELGQQK
SAWAAVPWFQHFRNATIGPPENIVVTPGGGSLIVTFSAPFDTGNPRDATFSYYVHYWEKG
GTQQVRDPVKSNSILLNNLKPFTVYCLQVQARLFWTRPKIINPGDFSNTFCEETTADAST
KLQQIILISMGTFSLLLVLTGACFFLVLKYQGLIKYWFHTPPSIPSQIEEYLKDPAQPIL
EVLDKDSSPKDDVWDSVSVISFPEKEGEDMEPKHGSSWGTPEVDAEQGS
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgcggcccccggccccggggctgtggcttttgctgtcgctctgctgcctcggaaccgct
gcgaccccatccgactcttcccagctggctgctccacggaacccgaagattcacctgtac
aatgctgagcagattctgagatgggaaccttcctccccaggcaatgacacagttccagtg
acctaccgggtgcagtttaaatacactggcagtaactggagcgacttcgagtccccggag
gtgaactgtacacagatctcagccacggagtgtaagttcgccacagccaccctctccgag
ggcttcccgaaggacttcaatgtctctctgcgagtgcgagcagagctgggacagcagaaa
tctgcctgggcagcagtgccttggtttcaacactttcgaaatgccaccatcgggccccca
gagaacatcgtggtcaccccaggaggaggctccctcatcgtcacgttttctgcacccttt
gacaccggaaaccccagggatgccactttttcctattacgtccattactgggaaaaaggt
ggaacccaacaggttagagaccctgtcaagagcaactccattttgctgaataacttgaaa
ccattcacagtgtactgtttacaagtccaggcacgactgttttggacaaggccaaagatc
attaatcccggggatttcagcaacacgttttgcgaagaaaccacggcagatgcctccacc
aagctgcagcagatcatcctgatctcgatgggaaccttttcgctgctgctggtgctgacg
ggggcctgtttcttcctggtcctaaaataccaagggctgattaaatactggtttcacact
ccaccaagcatcccatcacaaatagaagagtatttaaaggacccagcccagcccatctta
gaggtcctggacaaggacagttcgccaaaggatgacgtctgggattctgtgtccgtcatt
tcctttccagagaaggagggagaagacatggaaccaaagcacgggtccagctgggggacc
ccagaggtggacgctgagcagggaagctga

KEGG   Heterocephalus glaber (naked mole rat): 101725943
Entry
101725943         CDS       T02812                                 

Gene name
Il13ra2
Definition
(RefSeq) interleukin 13 receptor subunit alpha 2
  KO
K05077  interleukin 13 receptor alpha-2
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101725943 (Il13ra2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101725943 (Il13ra2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101725943 (Il13ra2)
   04090 CD molecules [BR:hgl04090]
    101725943 (Il13ra2)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL3 receptor family
   101725943 (Il13ra2)
CD molecules [BR:hgl04090]
 Proteins
  101725943 (Il13ra2)
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind fn3 LIFR_N Interfer-bind
Other DBs
NCBI-GeneID: 101725943
NCBI-ProteinID: XP_004874851
LinkDB
Position
Un
AA seq 386 aa
MAFICLDIECLYIFLLCTAFGYTLPSNMEIKVNPPQDFEIVDPGYLGYLYLQWQPPLAVD
NFKECTIEYELKYRNTDSESWKTIVTKNLHYKDGFDLNKGVEAKIHTLLSRHCTNGSEVQ
SSFSEATYWKPEQGSLETKIQDMDCVYYNWQYLLCSWKPGIGVQFDTNYNLFYWYEGLDN
VLQCVDYIKENGKNIGCKFPNLESSDYKDFFICVNGSSESKPVRSSYFIFQLQNIVKPLP
PDYLSLTVKNSFDIDLKWSIPKGPIPSRCFIYEILFTEDNSWMTNTVENEMHITRMLNES
QEFCFSVRSKVNIYCSDDGIWSEWSDEQCWEGDGWKENLTFFMIPFGIVSLFVLLLTCLL
LHKQKTLRKSIFHMKKEVFSHQETLC
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggctttcatttgtttggatatcgagtgcctatatatttttcttctttgcacagcattt
ggctatactttgccttcaaacatggaaataaaagttaatcctcctcaggactttgagata
gtggatcctggatatttaggttatctctatttgcaatggcaacctcccctggctgtggat
aattttaaggaatgcacaatagaatatgaattaaaataccgaaacactgacagtgaaagt
tggaagaccattgttactaagaatctacattacaaagatgggtttgatcttaacaagggt
gtcgaagcaaagatacacacgcttttgtcaaggcattgcacaaatggatcagaagttcag
agttcattttcagaagctacttactggaaaccagaacaaggaagtctggaaactaaaatt
caggatatggattgtgtatattacaactggcaatatttactctgttcttggaaacctggc
ataggtgtacaatttgataccaattacaacttgttctactggtatgagggtttggataat
gtattacagtgtgttgattacatcaaggaaaatggaaaaaatattggatgcaagtttcca
aacttggagtcatcagactataaagatttttttatctgtgttaatggatcatcagaatcc
aagcctgtcagatccagctatttcatttttcagcttcaaaatatagttaaacctttgcct
ccagactatcttagtcttactgtgaagaattcatttgacattgacctgaaatggagcata
cctaaaggacctattccatcaaggtgttttatttatgaaattttgttcacagaagataat
tcctggatgaccaatacagttgaaaatgaaatgcacatcacaagaatgttaaatgaaagc
caagaattctgcttttcagtaagaagcaaagtgaacatttattgctcagatgatgggatt
tggagtgagtggagtgatgaacaatgctgggaaggtgatggatggaaggaaaatttgacg
tttttcatgataccatttggtattgtctcattatttgttttgctactaacgtgtctgctt
ttgcataagcaaaaaactttacggaaatcaattttccatatgaagaaagaagttttttct
catcaagagacactctgttga

KEGG   Heterocephalus glaber (naked mole rat): 101726369
Entry
101726369         CDS       T02812                                 

Gene name
Il2rb
Definition
(RefSeq) interleukin 2 receptor subunit beta
  KO
K05069  interleukin 2 receptor beta
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04061  Viral protein interaction with cytokine and cytokine receptor
hgl04144  Endocytosis
hgl04151  PI3K-Akt signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl05162  Measles
hgl05166  Human T-cell leukemia virus 1 infection
hgl05200  Pathways in cancer
hgl05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101726369 (Il2rb)
   04151 PI3K-Akt signaling pathway
    101726369 (Il2rb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101726369 (Il2rb)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101726369 (Il2rb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101726369 (Il2rb)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101726369 (Il2rb)
   04659 Th17 cell differentiation
    101726369 (Il2rb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101726369 (Il2rb)
   05202 Transcriptional misregulation in cancer
    101726369 (Il2rb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101726369 (Il2rb)
   05162 Measles
    101726369 (Il2rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101726369 (Il2rb)
   04090 CD molecules [BR:hgl04090]
    101726369 (Il2rb)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL2 receptor family
   101726369 (Il2rb)
CD molecules [BR:hgl04090]
 Proteins
  101726369 (Il2rb)
SSDB
Motif
Pfam: IL2RB_N1 fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 101726369
NCBI-ProteinID: XP_004845727
LinkDB
Position
Un
AA seq 547 aa
MAAPALSWCLLLLLTLLLPLTTPSVSAEVTDTSQLECFYNSKANISCLWNREEGMQNTSC
HICARSDKRPWNRTCEMFPVSQTSWACNLVLGGPTSQPLTSVDIITAHVMCWEGGQWQMV
VTKNFKPFDYLRPVAPGSLQVTHVDTNRCNVTWHLTQISHYIDSYLEFEARTRLPGHSWE
EANRLSLKQRQQWIFLENLVPDTQYELQVRTRAERGLHTAWSPWSQALAFRTRPAAPRKE
SLPLTWVLGPALGLGLVSGIIISVYFLVSANCLGPWLKKVLKCHIPDPSEFFSQLNSEHG
GDFQKWLSSPFPSSSFSLGALAPEISPLEVLDRDTKATQLLLLQQDKALLPSPVPSGHSQ
TSCFTNQGYFFFHLPDALEIEACQVYFTYDPCAEAEPEEGVPPGFPLVPLLPLPSEDDAY
CTFPPGDDLLLFSPSLHSGPSVPHILPGPAGTSEERLRPSLQEGSPQDWGPPPLGFPIPA
APDPMGFQSALEQALGEAGEEAPAPEPRDGADSPRQGQVRPPTSPHADTDAYLSLQELQA
QDPAYLV
NT seq 1644 nt   +upstreamnt  +downstreamnt
atggcagccccggctctgtcctggtgcctcctcctcctgcttaccctcctcctgcccctg
acaacaccctcagtgtctgcagaggtgaccgacacttcccagcttgaatgcttctacaac
tccaaagcgaacatctcctgcctgtggaaccgggaggagggtatgcagaacacttcctgc
cacatctgcgccaggtcagacaagcggccctggaacaggacctgcgagatgttcccagtg
agccagacgtcctgggcctgtaatctggtcctcggaggccctacttctcagcccctgacc
tcggtggatatcattactgcacacgtgatgtgctgggaaggcggacagtggcaaatggtg
gtgaccaagaacttcaagccctttgactaccttcgcccagtggcccccggctctctccag
gtcacccacgtggacaccaacagatgcaatgtcacctggcacctcacccagatctcccac
tacatcgactcctacttggagtttgaggcccggacacgactgccaggccacagctgggag
gaggccaaccggttgagtctcaagcagaggcagcaatggatcttcctggagaacctggtg
cctgacacccagtacgagctacaggtgcggacgcgggccgagcgaggcctgcacaccgca
tggagtccctggagccaagccctggccttcaggaccaggcctgcagcccccaggaaggag
tccctgcccctcacttgggtcctcggccctgctctgggccttggactggtcagcggcatc
atcatctctgtgtacttcttggttagcgccaattgccttgggccttggctcaagaaggtt
ctgaagtgccacatcccagacccctcggagttcttctcccagctaaactccgagcacgga
ggggacttccagaagtggctgtcctcgcccttcccctcatcctccttcagcctgggggcc
ctggcacccgagatctcaccgctggaagtgctggacagggacaccaaggccacgcagctg
ctcctgctgcagcaggacaaggcgctgctgccctcgcccgtgcccagcggccactcccag
accagctgcttcaccaaccagggctacttcttcttccacctcccggatgccctggagatc
gaggcctgccaggtgtacttcacctatgacccctgtgctgaggcagagcctgaggagggt
gtgcccccggggtttcccctcgtgcccctgcttcccctgccatcagaggatgacgcctac
tgcacctttccccctggggacgacctgctgctcttctcccccagtctccacagtggccca
agcgtcccccacattctccctgggccagctgggaccagtgaagagaggctgcgcccctcc
ctgcaggagggctctccccaggactggggccccccgcccctggggttccctatcccagca
gcccctgacccaatgggtttccagtcagccctggagcaggctctgggggaggctggggag
gaggcccctgccccagagcccagggatggggctgactctcccaggcagggccaggtcagg
ccgccgacctctccccacgctgacaccgatgcctacctgtccctccaagaactccaggct
caggacccagcttacctggtgtag

DBGET integrated database retrieval system