KEGG   Heterocephalus glaber (naked mole rat): 101696702Help
Entry
101696702         CDS       T02812                                 

Gene name
Setdb2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101696702 (Setdb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hgl03036]
    101696702 (Setdb2)
Enzymes [BR:hgl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101696702 (Setdb2)
Chromosome and associated proteins [BR:hgl03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101696702 (Setdb2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101696702 (Setdb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD
Motif
Other DBs
NCBI-GeneID: 101696702
NCBI-ProteinID: XP_004844221
LinkDB All DBs
Position
Un
AA seq 704 aa AA seqDB search
MYKQHQKMGEKNGDAKSFWMELEDNGKVDFIFEKVQNVLQSLKQKIKDRSATNKEYIQAM
ILVNDATISKNSTLKKNHTSVTQSEQENKSNEFPSTSYKDFFPKDCTFLSIENNAVFPLE
NKVVDYRERKSPMNLSYQSHDCSGACLMKMPSTIKAENPLQLPITCHFQRRHAKTNSHSS
ALHVSYKAPCGRSLRNIEEVFRYLLETECNFLFTDNFSFNTYVQLTRNYQKQEEIVSDVD
ISNGAELVPISFCNEIDNRKLPQFKYRKTMWPPVYYLNNFSNMFTDSCDCSEGCIDITKC
ACLQLTARNAKTFSLSSDEITTGYKYKRLQRQIPTGIYECSLLCKCDPRMCQNRVVQHGP
QVRLQVFKTEKKGWGVRCLDDIDKGTFVCIYSGRLLNRANSEKPNATDENGKENIMKNMF
SKKRKIEVAHSDCEAEVGPLEMETHPRSAKTENCPPNLSHNPEEPVMEISCNNISRIQYY
SVIRSPKSKTAAFQENGKKMGFISLDSVTSGENNGFWNCKARRKQKDSNQVGDSEDNQLH
ESDVIDITKCREETPPGGRCNPATTFDNENIKKPFEVQIQKPQEEKSPAHQIHQVLSEEL
PSETKNTSGTSPVKSSKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVKTHDRNFPLV
AFFTHRFVKARTELTWDYGYKAGTLPNKEILCQCGANKCRKKIL
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtataaacagcaccaaaagatgggagaaaaaaatggtgatgcaaaaagtttttggatg
gagctagaggataatggaaaagtggacttcatatttgaaaaagtacaaaatgtgctgcag
tcactgaaacaaaagatcaaagatagatctgccacaaataaagaatacatccaagcaatg
atcctagtgaatgatgcaactataagtaaaaattcaacattgaaaaagaatcatacatct
gtgacgcagagtgaacaggaaaacaagtcaaatgaatttccttctacatcatacaaagac
ttctttccaaaagactgtacatttctatctatagaaaataatgcagttttccctctggaa
aataaagttgtagactatagagagagaaaatcacctatgaatttatcttaccaaagtcat
gactgttctggtgcctgtctgatgaaaatgccatcaaccatcaaggcagaaaaccctctg
caactaccaatcacatgtcacttccaaagacgacatgcaaagacaaactctcattcttca
gcacttcatgtgagttataaagctccttgtggaagaagtctgcggaacatagaggaagtc
tttcgttacctgcttgagaccgaatgtaactttttatttacagataacttttcttttaat
acttacgttcagttgactcggaattaccaaaagcaagaagaaattgtttctgatgtggat
attagcaatggtgcagaattagtacccatttctttctgtaatgaaattgacaatagaaag
cttccacagtttaagtacagaaagactatgtggccaccagtgtattatctgaacaacttt
tccaacatgtttactgattcctgtgactgttctgagggctgcatagacataacaaaatgt
gcatgtcttcagctaacagcaaggaatgccaaaactttttccttgtcaagtgatgaaata
actactggatataagtataaaagactgcagagacaaatacctactgggatttatgaatgt
agcctgttgtgcaagtgtgacccacgaatgtgtcaaaaccgagttgtccaacatggtcct
caagtgagactacaggtgttcaaaactgagaagaagggatggggtgtacgctgcctagat
gatattgacaaagggacatttgtttgcatttattcaggaagattactgaacagagctaac
tctgagaaacctaatgctactgatgaaaatggaaaagagaatattatgaaaaatatgttt
tcaaaaaagaggaaaatagaagttgcacattcagattgtgaggcggaagttggcccatta
gaaatggaaacacatcctagaagtgctaaaactgagaactgtccacctaacctcagtcat
aatccagaagagcctgtgatggaaataagctgtaataatatttcaagaattcaatattat
tcagttattagaagtcctaaatccaagacagctgcttttcaagagaatggaaaaaagatg
ggatttatttccttggattctgtcacctcgggagaaaacaatggattctggaattgtaaa
gccaggagaaaacaaaaggactcaaaccaagttggagattctgaagataaccagctacat
gaatcagatgtgatagatataactaaatgtagagaagaaactccaccagggggcagatgt
aacccagcaaccacatttgacaatgaaaatattaaaaaaccgtttgaggttcaaattcaa
aagccccaagaagaaaaatctccagcgcatcaaatccatcaggtcttgtctgaagagttg
ccaagtgaaaccaagaatacttcaggtacttctccagtgaagtccagtaaagggaatgtg
tttttattggatgccacaaaagaaggaaatgtgggccgcttccttaatcatagctgttgt
ccaaatctcttggtacagaatgtttttgtaaaaacacatgacaggaatttcccattggtg
gcattcttcacccacaggtttgtgaaagcaagaacagaactaacgtgggattatggttat
aaagctgggactttgcctaacaaggaaatcctttgccaatgtggggctaataagtgtaga
aaaaaaatattataa

DBGET integrated database retrieval system