KEGG   Heterocephalus glaber (naked mole rat): 101696721
Entry
101696721         CDS       T02812                                 

Gene name
Il3ra
Definition
(RefSeq) interleukin 3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04151  PI3K-Akt signaling pathway
hgl04210  Apoptosis
hgl04630  JAK-STAT signaling pathway
hgl04640  Hematopoietic cell lineage
hgl05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101696721 (Il3ra)
   04151 PI3K-Akt signaling pathway
    101696721 (Il3ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101696721 (Il3ra)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101696721 (Il3ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101696721 (Il3ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101696721 (Il3ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hgl04050]
    101696721 (Il3ra)
   04090 CD molecules [BR:hgl04090]
    101696721 (Il3ra)
Cytokine receptors [BR:hgl04050]
 Interleukin receptor families
  IL3 receptor family
   101696721 (Il3ra)
CD molecules [BR:hgl04090]
 Proteins
  101696721 (Il3ra)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind fn3 EpoR_lig-bind
Other DBs
NCBI-GeneID: 101696721
NCBI-ProteinID: XP_012921919
LinkDB
Position
Un
AA seq 434 aa
MSRGSGDVVKRISRHRPPASAQAGVRVFAALPGRSPAAPAAALSSRHCPGRQEEALPGQR
GAASSPLAPALAPGPGGSGGLRETREVAGFVLQVHASRVWSDSTMPGPWLSPPLLLLLLP
PACCPRPAAPELGVPIGNLRVEPGSRRLTWDLLGNASGIECFKDGSTCLMAYDKYCHYST
MSLCTVTNYTVKVTQPAFSAWILFPESGSNAEAAARDLKCKIFDGGPMVCSWAVGTGAPG
DVQYQLSWRNLESEEEGVCLRYNTDAQGRNIRCQFDQVRALPEFMMITVNGRSNGFRVPC
TDLSIELAAIAETLLPPNISTECNRTHVHLSWLPPRSHFRNNFKYELQTEQIPGGSPVPV
NSLSTNEFLLPNPGRCTVRIRARYRSNRWTAWSPPQAFGCDREESSQQQRLWPASVLAAL
GTLLLAAAALLLCR
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgtcccggggctcgggggatgtggtgaagcggatatcgcggcaccggccgccggcgtcg
gcccaggctggagtcagggtgttcgcagccctgccgggccggtccccagctgcacctgca
gctgcactgagttcccggcactgcccgggccggcaggaagaggctctgccagggcagcgg
ggggcggcttcctccccgctggctccagcgctggcgccaggccccggagggagcggcggc
ctcagggagacccgggaggtcgcgggctttgtcctgcaggtgcacgcgtcccgtgtctgg
agcgacagcaccatgccaggcccgtggctctcgccgccgctgctgctgctgctgctgccg
cccgcctgctgcccgcgtccggccgccccggagcttggtgtgcccatcgggaacctccgg
gtagagccgggcagcaggaggctgacctgggacctgctcgggaatgcgtcgggcatcgag
tgcttcaaagacggcagcacctgcctcatggcatatgacaagtactgccactacagcacg
atgtccttgtgcactgtgacaaactacacggtcaaggtgacccagccggcgttctcagct
tggatcctctttcctgagtcaggtagcaatgcagaggcagcagccagggacttgaagtgc
aagattttcgacgggggccccatggtctgcagctgggcagtgggcaccggggccccggga
gacgtgcagtaccagctgtcctggaggaaccttgaatcagaggaggagggcgtgtgtctc
cgttacaacacggacgcccagggcaggaacatcagatgccagttcgatcaagtccgtgcg
cttcccgaattcatgatgatcacagtgaacgggaggagcaatggcttccgtgtgccctgc
acagacttaagcatcgagttggcagccattgcagagactctcctgccccccaacatcagc
accgagtgcaaccgcacccacgtgcacctgtcctggctgccgccgcggagccacttccgg
aacaatttcaagtacgagctccagaccgaacagatcccgggcggctctccggtccctgtc
aacagcctcagcacgaacgagttcctcctgcccaaccctgggcggtgcaccgtgcggatt
cgagcgcgctatcggtccaacaggtggacggcgtggagcccgccccaggccttcggctgt
gaccgggaggagagctcgcagcagcagcggctgtggcccgcgtccgtgctggcggcgctg
gggacgctgctcctggcggcggcggccttgctcctctgcaggtga

DBGET integrated database retrieval system