KEGG   Heterocephalus glaber (naked mole rat): 101696723
Entry
101696723         CDS       T02812                                 

Gene name
Prl
Definition
(RefSeq) prolactin
  KO
K05439  prolactin
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04080  Neuroactive ligand-receptor interaction
hgl04151  PI3K-Akt signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101696723 (Prl)
   04151 PI3K-Akt signaling pathway
    101696723 (Prl)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101696723 (Prl)
   04060 Cytokine-cytokine receptor interaction
    101696723 (Prl)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101696723 (Prl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101696723 (Prl)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  CSF and other factors
   101696723 (Prl)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 101696723
NCBI-ProteinID: XP_004847671
UniProt: A0A0P6JT58
LinkDB
Position
Un
AA seq 225 aa
MDSKRQAGSLLLLLLMSNLLLCKNVASEPICPNRSGCQVSLRELFDRAIILSHYIHSLSS
EIFQEFDAQYSQGPGFFTQAISMCHTASISTPAGKEQAQQIQQKDFVILVIHLLGSWTKP
LSHLITEARRLPKAPDALIAKATEIQEQNQRLLEGLKKIGKLVDPEIIDNGNYAVWLGLP
SLQSNDLQSLLFAYHNLFRCLRRDTHKVDNYLKFLKCQIAYDGSC
NT seq 678 nt   +upstreamnt  +downstreamnt
atggacagcaagaggcaagctgggtcactcttactgctgctacttatgtcaaacctcctc
ctgtgcaagaacgtggcttccgagcccatctgtcccaacaggtctggctgccaggtgtcc
ctccgagagctatttgatcgggccatcatcctgtctcattacatccatagcctctcttcc
gaaattttccaggaatttgatgcgcagtattcccagggcccagggttctttacccaggcc
atcagcatgtgccacactgcatccatctccactccagctggcaaggagcaggcccagcaa
atccaacaaaaagactttgtcattctggttatccatttgctgggctcctggactaaacct
ctgagccacctcatcacagaagcacgtcgcctgccaaaagcccctgatgctctcatagca
aaagccacggagattcaggaacaaaaccaacgacttctagaaggcctgaagaagataggc
aagctggttgatcctgaaattatagacaatgggaactatgctgtctggctgggacttcca
tccctgcaatcaaatgatttacaatcgctcctgtttgcttatcataacttgttccgctgc
ctgcgcagggatacacataaggttgacaattatctcaagttcctgaaatgccaaatcgcc
tatgatggcagctgctaa

KEGG   Heterocephalus glaber (naked mole rat): 101698554
Entry
101698554         CDS       T02812                                 

Gene name
Csf3
Definition
(RefSeq) colony stimulating factor 3
  KO
K05423  granulocyte colony-stimulating factor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04151  PI3K-Akt signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04640  Hematopoietic cell lineage
hgl04657  IL-17 signaling pathway
hgl05144  Malaria
hgl05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101698554 (Csf3)
   04151 PI3K-Akt signaling pathway
    101698554 (Csf3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101698554 (Csf3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101698554 (Csf3)
   04657 IL-17 signaling pathway
    101698554 (Csf3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101698554 (Csf3)
  09174 Infectious disease: parasitic
   05144 Malaria
    101698554 (Csf3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101698554 (Csf3)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  CSF and other factors
   101698554 (Csf3)
SSDB
Motif
Pfam: GCSF IL6 IL11
Other DBs
NCBI-GeneID: 101698554
NCBI-ProteinID: XP_004859520
UniProt: G5BRY2
LinkDB
Position
Un
AA seq 205 aa
MAHAAAPRPVKLMALLLLLHSALWPGHKAAPLDTASPLPLPRSFVLKCLEQARRVQAEAV
EMQQKLCATYRLCHPEELTLLGHSLSIPWVPLKGCSSQDLQPTRCLRQLQAGLVLYRGLL
RALVGISPELSPTVDTLQLDVADFATTIWQQMEDLGTAPAVQPTPGTMLTFTSAFQRQAV
GAMVASQLQCFLELAYRALRYLRGP
NT seq 618 nt   +upstreamnt  +downstreamnt
atggcccacgctgctgccccgcggcctgtgaagctgatggccctactgctgctcttgcac
agtgcgctctggcccggacacaaggccgcgcccctggacactgccagccccctgcccctg
ccccgaagcttcgtgctcaagtgcttggagcaggcacggagggtccaggccgaagccgtg
gagatgcagcagaagctatgtgccacgtacaggctgtgccaccccgaggagctgacactg
ctgggccactccctgagcatcccatgggtccccctgaagggctgctccagccaggacctg
cagccgacccgctgcctgcgccagctccaggccggcctggtcctctaccggggcctcctg
cgggcactggtggggatctccccagaactgtcccccactgtggacacgctgcagctggat
gttgctgactttgccaccaccatctggcagcagatggaggacctgggaacagccccggcc
gtgcagcccaccccgggcaccatgctgaccttcacctctgccttccagcgccaggcagtc
ggggcgatggtggcctcgcagctgcagtgcttcctggagctggcctaccgtgccctgcgc
tacctcagggggccctga

KEGG   Heterocephalus glaber (naked mole rat): 101699327
Entry
101699327         CDS       T02812                                 

Definition
(RefSeq) prolactin-like
  KO
K05439  prolactin
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04080  Neuroactive ligand-receptor interaction
hgl04151  PI3K-Akt signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101699327
   04151 PI3K-Akt signaling pathway
    101699327
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101699327
   04060 Cytokine-cytokine receptor interaction
    101699327
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101699327
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101699327
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  CSF and other factors
   101699327
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 101699327
NCBI-ProteinID: XP_004847945
LinkDB
Position
Un
AA seq 190 aa
MHLSQQVIQGVVVLIGVTDPDCQGEIGLVLRSGGPLLLLLASTLVLSQNEASHSTCVPGD
KCHLILQELYHSATYLSQSMHFYALDLFLELTEVYSHRPGYFSPAKKRCHMADILTPAER
EEARLMQLDLEVSEEKDFALRSEMESLTSSDEKRQLFALYNLLRCFVIDAEKINFLLSFL
KCQAANNGSC
NT seq 573 nt   +upstreamnt  +downstreamnt
atgcacctgagtcaacaggttatacagggagttgtggtgctgattggtgtgactgaccca
gactgccaaggagaaattggactggtgctccgcagtggagggcccctcctcctgctgctg
gcatccaccctggtcctgagccagaatgaggcctcccatagcacttgtgttccgggggac
aaatgtcacctgattctccaggaactgtatcatagtgcaacctatttgtctcagagcatg
catttctatgctttagacctgttcttggagttgacggaggtgtattcccatcgaccaggc
tacttctcaccagccaaaaaacggtgccacatggctgatatcctcactccagctgagcgg
gaggaggccaggctgatgcagcttgaccttgaagtctcagaggaaaaggactttgctttg
aggtcagagatggaatcactgacgtcatctgatgaaaaacgtcagctgtttgctctttat
aacttgcttcgctgctttgttatcgatgcagaaaagattaactttcttctctcgttcctg
aagtgccaagctgccaacaatggcagctgctaa

KEGG   Heterocephalus glaber (naked mole rat): 101705058
Entry
101705058         CDS       T02812                                 

Gene name
Thpo
Definition
(RefSeq) thrombopoietin
  KO
K06854  thrombopoietin
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
hgl04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101705058 (Thpo)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101705058 (Thpo)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101705058 (Thpo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101705058 (Thpo)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  CSF and other factors
   101705058 (Thpo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 101705058
NCBI-ProteinID: XP_004834916
UniProt: A0A0N8ETQ2
LinkDB
Position
Un
AA seq 350 aa
MQLTELLLAVLLLTARLTLSSPAPPACDPRLLHKLLRDSHVLHGRLSQCPDVNPLSTPVL
LPAVDFSLGEWKAQTEQTKAQDILGAVTLLLEGVMAARGQLGPTCLASLLGQLSGQVRLL
LGALQGLLGTQLPPQGRTTVHKDPNAIFLSFQQLLRGKVRFLLLVGGPTLCARRALPTTA
VPSSSSLFLPLNKLPNRTSALLETNFSVSARTTGSGPLNRLQGFRAKIPGLLNQTSGSSD
QIPGHLNGTHRPLNGTHGLLPGASPRALEVPDIPPGTSDTGFRPPHLQTGYSPSTALPPA
GQYTLFAPSPTLPTPVGQLQPLLPDPSITPNSSSPLAEAHPHPESVSQEG
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgcagctgactgaattgctcctggcggtccttcttcttactgcaagactaactctgtcc
agcccagctccacctgcctgtgacccccgactcctacataaactgcttcgtgactctcat
gtccttcatggcagactgagccagtgcccagacgttaaccctttgtccacacctgtcctg
ctgcctgctgtggacttcagcttgggagaatggaaagctcagacggagcagaccaaagca
caggacattctaggtgcagtgacccttctgctggagggagtgatggcagctcggggacag
ctgggacccacgtgcctcgcatccctcctgggacagctttctggacaggtccgactcctc
cttggggccctgcagggcctcctggggacccagcttcctccacagggcagaaccacagtt
cacaaggaccccaatgccatcttcctgagcttccagcaacttctccgaggaaaggtgcgt
ttcctgctgcttgtaggagggcccaccctctgtgccaggcgggccctgcccaccaccgca
gtcccaagcagttcctctctgttcctcccactaaacaagctcccaaacaggacttctgcg
ttgctggagacgaacttcagtgtctcagccagaactactggctctggacctctgaacagg
ctgcagggattcagagccaagattccaggtctgctgaatcagacttccgggtcttcagat
caaatccctggacacctgaatgggacacacagacccttgaacggaactcatggactcctt
cctggagcctcacccagggccctagaagtcccagacattccaccaggaacttcagacaca
ggcttccggccaccccacctccagaccggatattctccttccacggcccttcctcctgct
ggacagtacacactcttcgctccttcacccaccttgcccacacctgtgggccagctccag
cccctgcttcctgacccttctatcacacccaactccagcagccctctggccgaagcccac
cctcaccctgagagtgtgtctcaggaaggataa

KEGG   Heterocephalus glaber (naked mole rat): 101712254
Entry
101712254         CDS       T02812                                 

Gene name
Gh1
Definition
(RefSeq) growth hormone 1
  KO
K05438  growth hormone
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04080  Neuroactive ligand-receptor interaction
hgl04151  PI3K-Akt signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101712254 (Gh1)
   04151 PI3K-Akt signaling pathway
    101712254 (Gh1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101712254 (Gh1)
   04060 Cytokine-cytokine receptor interaction
    101712254 (Gh1)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    101712254 (Gh1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101712254 (Gh1)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  CSF and other factors
   101712254 (Gh1)
SSDB
Motif
Pfam: Hormone_1 DUF5798
Other DBs
NCBI-GeneID: 101712254
NCBI-ProteinID: XP_004868690
UniProt: G5BDI6
LinkDB
Position
Un
AA seq 216 aa
MATGSRTTWLLVFVLLCLPQPQEVGAFPAMPLSSLFTNAVLRAQHLHQLAADTYKEFERA
YIPEGQRYSLQNTQAAFCFSESIPAPTGKEEAQQRSDMELLRFSLLLIQSWLGPVQFLSR
VFTNSLVFGTSDRVYEKLKDLEEGIQALMQELEDGSPRAGQILKQTYDKFDTNLRSSDAL
LKNYGLLSCFRKDLHKTETYLRVMKCRRFVETSCVF
NT seq 651 nt   +upstreamnt  +downstreamnt
atggctacaggctctcggaccacctggctcctagtcttcgtcctgctctgcctgccccag
cctcaggaggtcggggccttcccagccatgcctttgtcaagcctgtttaccaatgcagtg
ctccgagcacagcacttgcaccagctggccgctgacacctacaaagaatttgagcgtgcc
tacatccccgagggacaacgttactccctccagaacacccaagctgccttctgcttctcg
gagtccatcccagcccccacgggcaaagaagaggcccagcagagatcagacatggagctg
ctgcgcttctcactgctgctcatccagtcgtggttggggcctgtgcagtttctcagcagg
gtcttcaccaacagcctggtgtttggcacctcagaccgtgtctatgagaaactgaaggac
ctggaggagggcatccaggcgctgatgcaggagctggaagatggcagcccccgggctgga
cagatcctcaagcaaacctatgacaagtttgacaccaacttacgcagcagtgatgcactg
ctcaagaactacgggctgctctcctgcttcaggaaggacctgcacaagactgagacctac
ctgcgggtcatgaagtgtcgccgctttgtggaaaccagctgtgtcttctag

KEGG   Heterocephalus glaber (naked mole rat): 101713822
Entry
101713822         CDS       T02812                                 

Gene name
Cntf
Definition
(RefSeq) ciliary neurotrophic factor
  KO
K05420  ciliary neurotrophic factor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101713822 (Cntf)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101713822 (Cntf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101713822 (Cntf)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  CSF and other factors
   101713822 (Cntf)
SSDB
Motif
Pfam: CNTF
Other DBs
NCBI-GeneID: 101713822
NCBI-ProteinID: XP_004869796
UniProt: G5AP46
LinkDB
Position
Un
AA seq 198 aa
MAFAELSPLTPHRRDLCSRSIWLARKIRSDLTALMDSYVKHQGLSENVSLDAVGGVPAAS
IAQWSELTEAERLQENLHAYRTFHVLLARLLEDQQVHFTPTESDFHQAIRSLGLQVSAFA
YQLEELMVLLEHEIPPNETSGVPLGEGGLFEKKLWGLKVLQELSQWTVRSIRDLRLISSQ
PAGIPADESRYFAKDEKM
NT seq 597 nt   +upstreamnt  +downstreamnt
atggcttttgcagagctttcaccactgacccctcatcgtcgggacctctgtagccgttct
atctggctagcaaggaagattcgttcagacctgactgctctcatggactcttacgtgaag
catcagggcctgagcgagaacgtgagcctggacgctgtgggcggagtgccggctgcgagc
atcgctcagtggagcgagctgactgaggccgagcggctccaggagaacctgcacgcttac
cgcaccttccacgtgctgctggccaggcttctggaagaccagcaggtgcacttcaccccc
accgagagcgacttccaccaggccatacgctcgctggggctccaggtttccgcctttgcc
taccagctggaggagttgatggtgctcctggaacacgagatccccccaaatgagaccagc
ggggtgcctctgggagagggggggctctttgagaagaagctgtggggcctgaaggtgctg
caggagctttcccagtggaccgtgaggtccatccgtgacctgcggctcatctcctcacag
ccggcggggatcccggcagatgagagccggtactttgccaaggatgagaaaatgtag

KEGG   Heterocephalus glaber (naked mole rat): 101722703
Entry
101722703         CDS       T02812                                 

Gene name
Lep
Definition
(RefSeq) leptin
  KO
K05424  leptin
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04080  Neuroactive ligand-receptor interaction
hgl04152  AMPK signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04920  Adipocytokine signaling pathway
hgl04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101722703 (Lep)
   04152 AMPK signaling pathway
    101722703 (Lep)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101722703 (Lep)
   04060 Cytokine-cytokine receptor interaction
    101722703 (Lep)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101722703 (Lep)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101722703 (Lep)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101722703 (Lep)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  CSF and other factors
   101722703 (Lep)
SSDB
Motif
Pfam: Leptin
Other DBs
NCBI-GeneID: 101722703
NCBI-ProteinID: XP_004856459
UniProt: G5BHA4
LinkDB
Position
Un
AA seq 167 aa
MRCGPLCLFLWLWLYLSYIQAVPIQKVQDDTKTLIKTIVSRINDISHMQSVSSKHKVTGL
DFIPLYPDLSFSKMDQTLAVYQQIISNLPSRRNMVQISNDLDNLQNLVHMLASSKGCPLP
QTRGPELLENLGGALKESIYSTEVVALSRLQRFLQEMLLQLDHNTMC
NT seq 504 nt   +upstreamnt  +downstreamnt
atgcgctgtggacccctgtgcctgttcctgtggctttggctctatctatcctacattcaa
gctgtacccatccaaaaagtccaggatgacaccaagaccctcatcaagaccattgtctcc
aggatcaatgacatttcacacatgcaatcagtgtcctccaaacacaaggtcactggttta
gacttcattcctctctacccggacctgagcttctccaagatggaccagacattggcagtc
tatcaacagatcatcagcaatctgccttcccgaagaaatatggtgcaaatatctaatgac
ctggataatctccagaatcttgtccacatgctggcctcttctaagggttgccctctgccc
caaaccaggggcccagagcttctggagaacctgggtggtgccctcaaagaatcaatctac
tccacagaggtggtggccctcagcaggctgcagaggtttctgcaggaaatgctgctgcag
ctagaccacaacaccatgtgctga

KEGG   Heterocephalus glaber (naked mole rat): 106009625
Entry
106009625         CDS       T02812                                 

Definition
(RefSeq) prolactin-like
  KO
K05439  prolactin
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04080  Neuroactive ligand-receptor interaction
hgl04151  PI3K-Akt signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    106009625
   04151 PI3K-Akt signaling pathway
    106009625
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106009625
   04060 Cytokine-cytokine receptor interaction
    106009625
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    106009625
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    106009625
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  CSF and other factors
   106009625
SSDB
Motif
Pfam: Hormone_1 DUF4092
Other DBs
NCBI-GeneID: 106009625
NCBI-ProteinID: XP_012928656
LinkDB
Position
Un
AA seq 130 aa
MIVTVEGKGKGSLLLLLLMSSLLLCEDVACHPLCGNECPPLYTNLFLPMVAASHYVYFTA
KKLFLDFFDPEITSKVDYAVWTELPSLQSADKITRLFATYNLLRCLFGDFRMVGGYLKWL
LCQFAESFEC
NT seq 393 nt   +upstreamnt  +downstreamnt
atgatcgtcactgtggaaggcaaggggaaagggtccctcctgctgctgctgctcatgtca
agcctgctcctgtgtgaggacgtggcctgccatcctctctgtggcaatgaatgccccccg
ctgtatacaaacctatttctacccatggttgctgcatctcattacgtgtactttactgct
aaaaaactcttcttggatttttttgatcctgaaatcacaagcaaagtggactatgctgtc
tggacagaacttccatccctgcaatcagctgataaaatcactcgcctgtttgctacttat
aatctgctccgatgcttgtttggggatttccgtatggttggtggttatctcaagtggttg
ttgtgccaatttgctgaatcttttgagtgttaa

DBGET integrated database retrieval system