KEGG   Heterocephalus glaber (naked mole rat): 101697092
Entry
101697092         CDS       T02812                                 

Gene name
Kitlg
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04010  MAPK signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04640  Hematopoietic cell lineage
hgl04916  Melanogenesis
hgl05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101697092 (Kitlg)
   04014 Ras signaling pathway
    101697092 (Kitlg)
   04015 Rap1 signaling pathway
    101697092 (Kitlg)
   04072 Phospholipase D signaling pathway
    101697092 (Kitlg)
   04151 PI3K-Akt signaling pathway
    101697092 (Kitlg)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101697092 (Kitlg)
  09152 Endocrine system
   04916 Melanogenesis
    101697092 (Kitlg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101697092 (Kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101697092 (Kitlg)
Cytokines and growth factors [BR:hgl04052]
 Growth factors
  Growth factors (RTK binding)
   101697092 (Kitlg)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 101697092
NCBI-ProteinID: XP_004867599
LinkDB
Position
Un
AA seq 294 aa
MKKTQTWIITCIYLQLLLFNPLVKTKEICGNPVTDNVKDITKLVANLPKDYLITLNYVTG
MDVLPSHCWLRQMVTQLSVSLTNLLDKFSNISEGLSNYSIIDKLGKIVDDLVECMETSFK
NVKESSKRPEPRLFTPEEFFRIFNRSIDAFKDFMVASETSDCVVSSTLSPEKDSRVSVTK
PFMLPPVAASSLKNDSSSSNSKAVDSIGDPNLQWAAMALPAFFSLVIGFAFGALYWKKKQ
PNLSRAGENIQINEEDNEIRYFALLTMRISKHDIVISLTEHVHFHDVKKLSFMR
NT seq 885 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgtatttatcttcagctgctcctatttaat
cctcttgtcaaaactaaagagatctgcgggaatcctgtgactgataatgtaaaagacatc
acaaaattggtagcaaatcttccaaaagattacctgataaccctcaactatgtcaccggg
atggatgttttgcctagtcattgttggttacgccagatggtaacacagttgtcagtcagc
ttgactaatcttctggacaagttttcaaatatttctgaaggtttaagtaattactctatc
atagacaaacttgggaagatagttgatgaccttgtggagtgcatggaaacctcatttaag
aatgtgaaagaatcctctaagaggcctgaacccagactctttactcctgaagaattcttt
agaatttttaacagatccatcgatgccttcaaggactttatggtggcctctgaaactagt
gattgtgtggtttcgtcaacactgagccccgagaaagattccagagtcagtgtcacaaaa
ccatttatgttaccccctgttgcagccagctcccttaagaatgacagcagtagcagtaat
agcaaggctgtagattccatcggtgaccccaacctgcagtgggcagccatggctttgccc
gccttcttttctcttgtaattggctttgcttttggagccttatactggaagaagaaacaa
ccaaatctttcaagagcaggtgaaaatatacagattaatgaagaagataatgagataagg
tattttgctttgctaactatgaggataagcaagcatgacattgttatttctcttactgag
catgtacattttcatgatgttaagaagttaagtttcatgaggtag

DBGET integrated database retrieval system