KEGG   Heterocephalus glaber (naked mole rat): 101697126
Entry
101697126         CDS       T02812                                 

Gene name
Traf6
Definition
(RefSeq) TNF receptor associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04010  MAPK signaling pathway
hgl04064  NF-kappa B signaling pathway
hgl04120  Ubiquitin mediated proteolysis
hgl04140  Autophagy - animal
hgl04144  Endocytosis
hgl04380  Osteoclast differentiation
hgl04620  Toll-like receptor signaling pathway
hgl04621  NOD-like receptor signaling pathway
hgl04622  RIG-I-like receptor signaling pathway
hgl04657  IL-17 signaling pathway
hgl04722  Neurotrophin signaling pathway
hgl05132  Salmonella infection
hgl05133  Pertussis
hgl05135  Yersinia infection
hgl05140  Leishmaniasis
hgl05142  Chagas disease
hgl05145  Toxoplasmosis
hgl05152  Tuberculosis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05222  Small cell lung cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101697126 (Traf6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101697126 (Traf6)
   04064 NF-kappa B signaling pathway
    101697126 (Traf6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101697126 (Traf6)
   04140 Autophagy - animal
    101697126 (Traf6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101697126 (Traf6)
   04621 NOD-like receptor signaling pathway
    101697126 (Traf6)
   04622 RIG-I-like receptor signaling pathway
    101697126 (Traf6)
   04657 IL-17 signaling pathway
    101697126 (Traf6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101697126 (Traf6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101697126 (Traf6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101697126 (Traf6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101697126 (Traf6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101697126 (Traf6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101697126 (Traf6)
   05135 Yersinia infection
    101697126 (Traf6)
   05133 Pertussis
    101697126 (Traf6)
   05152 Tuberculosis
    101697126 (Traf6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101697126 (Traf6)
   05161 Hepatitis B
    101697126 (Traf6)
   05160 Hepatitis C
    101697126 (Traf6)
   05171 Coronavirus disease - COVID-19
    101697126 (Traf6)
   05162 Measles
    101697126 (Traf6)
   05168 Herpes simplex virus 1 infection
    101697126 (Traf6)
   05169 Epstein-Barr virus infection
    101697126 (Traf6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101697126 (Traf6)
   05140 Leishmaniasis
    101697126 (Traf6)
   05142 Chagas disease
    101697126 (Traf6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101697126 (Traf6)
   04121 Ubiquitin system [BR:hgl04121]
    101697126 (Traf6)
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101697126 (Traf6)
Membrane trafficking [BR:hgl04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101697126 (Traf6)
Ubiquitin system [BR:hgl04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    101697126 (Traf6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 zf-RING_5 U-box SlyX Tropomyosin_1 DUF16 PspA_IM30 UPF0242 Spc29 DUF1664
Other DBs
NCBI-GeneID: 101697126
NCBI-ProteinID: XP_004852082
UniProt: G5B132
LinkDB
Position
Un
AA seq 543 aa
MSLINCENSCGSSQSESDCCAAMASSCSTAAKDDSVSGVPSTSTGNLSSSFMEEIQGYDV
EFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLF
PDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQVLCEFALVNCSQCQRPFQKCQLNIHI
LTDCPRRQVSCVNCAVSMPFEEKEIHDQNCPLANVICEYCHTMLIREQMPTHYDLDCPTA
PIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLNLALTPVPPRDLLPYDAA
SLPRVSSGCHPEVQNFQETIQQLEGRLVRQDHQIRELTAKMETQCMYVNELKGTIRTLED
KVAEIEAQQCNGIYIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPT
AQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAF
QRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGGLRKEGFQPRSTD
AGV
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgagtctgataaactgtgaaaacagctgtggatccagccagtctgaaagcgactgctgt
gctgccatggccagctcctgtagcactgcagcgaaagacgacagtgtgagcggggtgccc
agcaccagcacggggaacctgtccagctccttcatggaggagatccagggatatgatgta
gagtttgacccgcccctggaaagcaagtacgagtgccccatctgcttgatggctctgcgg
gaagcagtgcagacgccgtgtggccatcggttctgcaaggcctgcatcatcaaatcaata
agggatgcaggtcacaaatgtccagttgacaacgaaatactgctggaaaatcaactattt
cctgataattttgcaaaacgagagattctctctctgatggtaaagtgtccaaatgaaggt
tgtttgcacaagatggaattgaggcatcttgaggaccatcaagtactctgtgagtttgct
cttgtgaattgttcccaatgccagcgcccctttcaaaaatgccagttgaatattcatatc
ctcacggattgtccaaggagacaggtttcttgtgtaaactgtgctgtatccatgcctttt
gaggaaaaggagatccatgaccagaactgtcctttggcaaatgtcatctgtgaatattgc
cacaccatgctcatcagagaacagatgcctactcattatgatctagactgtcctacagcc
ccgatcccctgcaccttcagtacttttggttgccatgaaaagatgcagagaaatcacttg
gcacgccacctgcaagagaatacccagtcgcacatgagaatgttggctcaggctgttcat
agtttaaaccttgctttaactcctgtgcctccacgtgacctgcttccatacgatgctgcc
tctctgccccgggtttcctctgggtgccacccagaggtccagaatttccaggaaaccatt
caacagttagagggtcgccttgtaagacaggaccatcaaatccgggagctgactgcgaaa
atggaaactcagtgtatgtatgtaaatgagcttaaaggaactattcgaaccctcgaggac
aaagtcgctgaaattgaagcacagcagtgcaatgggatttacatttggaaaattggcaac
tttggcatgcacttaaagtctcaagaagaggagaagcctgttgtcattcatagccctgga
ttctacacaggcaaacccgggtacaaactgtgcatgcgcctgcaccttcagttaccaact
gctcagcgctgtgcaaactatatatccctctttgtccacacaatgcaaggagagtatgac
agccacctcccttggcccttccagggtacaatacgccttacaattcttgatcagtctgaa
gccccagtaaggcaaaaccacgaagagataatggatgccaaaccagagctgcttgccttc
cagcggcccacaatcccacggaatccaaaaggttttggctatgtaactttcatgcacttg
gaagccctaagacaaagaaccttcattaaggatgatacgttgttagtgcgctgtgaagtt
tctacccgcttcgacatgggtggccttcgcaaggagggttttcagccacggagtactgat
gcaggggtatag

DBGET integrated database retrieval system