KEGG   Heterocephalus glaber (naked mole rat): 101697360
Entry
101697360         CDS       T02812                                 

Gene name
Pdgfra
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl04010  MAPK signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04020  Calcium signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04144  Endocytosis
hgl04151  PI3K-Akt signaling pathway
hgl04510  Focal adhesion
hgl04540  Gap junction
hgl04630  JAK-STAT signaling pathway
hgl04810  Regulation of actin cytoskeleton
hgl05163  Human cytomegalovirus infection
hgl05200  Pathways in cancer
hgl05206  MicroRNAs in cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05230  Central carbon metabolism in cancer
hgl05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101697360 (Pdgfra)
   04014 Ras signaling pathway
    101697360 (Pdgfra)
   04015 Rap1 signaling pathway
    101697360 (Pdgfra)
   04630 JAK-STAT signaling pathway
    101697360 (Pdgfra)
   04020 Calcium signaling pathway
    101697360 (Pdgfra)
   04072 Phospholipase D signaling pathway
    101697360 (Pdgfra)
   04151 PI3K-Akt signaling pathway
    101697360 (Pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101697360 (Pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101697360 (Pdgfra)
   04540 Gap junction
    101697360 (Pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101697360 (Pdgfra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101697360 (Pdgfra)
   05206 MicroRNAs in cancer
    101697360 (Pdgfra)
   05230 Central carbon metabolism in cancer
    101697360 (Pdgfra)
   05231 Choline metabolism in cancer
    101697360 (Pdgfra)
  09162 Cancer: specific types
   05214 Glioma
    101697360 (Pdgfra)
   05218 Melanoma
    101697360 (Pdgfra)
   05215 Prostate cancer
    101697360 (Pdgfra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101697360 (Pdgfra)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101697360 (Pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101697360 (Pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hgl04090]
    101697360 (Pdgfra)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101697360 (Pdgfra)
Protein kinases [BR:hgl01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101697360 (Pdgfra)
CD molecules [BR:hgl04090]
 Proteins
  101697360 (Pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE DUF3475 Kinase-like
Other DBs
NCBI-GeneID: 101697360
NCBI-ProteinID: XP_004849765
UniProt: G5C9U9
LinkDB
Position
Un
AA seq 1089 aa
MGTSCPAFLVLGCLLTELSLILCQLPLPSILPNEDEKVVQLNSSFSLRCFGESEVSWKYP
MTPGDVPDVEIRNEENNSGLFVAVLEVANALAAHTGWYTCYYNHTQTEEGEVQGRHLYVY
VPDPDVAFLPLEMTDYIVLADTDDSAIIPCRTTDPKTPVTLHNSQGLVPASYNSKQGFNG
TFDMGPYFCEAIVRGKTFQTMLFNIVTLKAAPQLDLEMEALKTVYKSGETIEVTCAVFNN
EVVDLQWSYPGVVKGKGILKLQEIRFPTIKLVYTLTVPDATVKDSGDYECIARHATEDVK
EMKKVTISVHEKGFVEIRPTFGHKEAVNLHEVRHFVVDIQAYPPPRIAWLKDNLTLIENL
TEITTDVEKIREIRYRSKLKLIRAKEEDSGYYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSAGGQTVRCMAEGVPLPDIEWMICRDIKRCNNETSWTVLANNVSNIIMEIHPQG
RSIVEGRVTFAKVEETIAVRCVAKNLLGSGNRELKLVVPTLHSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSQHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADATQYVPMLERKEVSKYSDIQRSLYDRPVSYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYDIMMQCWNSEPEKRPSFYHLSEIVESLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNTYIGVIYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacatcctgcccggccttcttggtccttggctgtctcctcacagagctgagccta
atcctctgccagcttccactgccctccatccttccaaatgaagatgaaaaggtcgtgcag
ctgaattcatccttttctctgcggtgcttcggggagagtgaagtgagctggaagtacccc
atgactccaggagacgtccccgacgtggagatcagaaatgaggaaaacaacagcggcctt
tttgtggcggtgctggaagtggccaatgccttggcggcccacaccggctggtacacttgc
tactacaaccacacacagacggaggagggcgaggtccagggcaggcacctttacgtctat
gtgccggacccagatgtggcctttttgcctctagaaatgacagattacatagtcctcgca
gacaccgatgactctgccatcataccctgtcgcacaacagatcccaagactcccgtaacc
ttacacaacagccaggggctggtgccagcctcctacaacagcaaacagggttttaatggg
accttcgacatggggccctacttctgcgaggccattgtccgagggaagacgttccagaca
atgctgtttaatattgttactttgaaagctgcaccacagctggatcttgaaatggaagct
ctgaaaactgtgtataagtccggggaaactatcgaggtcacctgcgctgtctttaacaat
gaagtggttgaccttcaatggagttaccctggagtagtgaaaggcaaaggcatcctgaag
ctgcaggaaatcagatttccgaccatcaagttagtgtacactctgacggtccctgacgcc
acagtgaaagatagcggcgactatgaatgtatcgctcgtcatgccaccgaggatgtcaaa
gaaatgaagaaagtcaccatttccgtacatgagaaagggtttgttgagatcaggcctact
tttggccacaaggaagctgtcaacctgcatgaagtcagacattttgtggtggacatacag
gcctacccacctccccggatagcctggctgaaggacaacctgacactgattgaaaacctc
actgagatcaccactgatgtggaaaagattcgggaaataaggtatcgaagcaaactgaag
ctgatccgtgccaaggaagaagacagtggctattatactattgtggttcaaaatgaagac
gacgtgaagagctacacttttgaactgttaactcaagttccctcatccatcttggacctg
gttgatgaccaccatggctctgcagggggacagactgtgaggtgcatggctgaaggcgtt
cctcttcctgacattgagtggatgatctgcagggacattaagagatgtaataatgaaacg
tcttggacagttttggccaacaatgtctcaaatatcatcatggagatacatccccagggc
aggagtattgtggagggccgagtgacattcgccaaagtggaggagaccattgcagttcga
tgtgtggccaagaatctccttgggtctgggaaccgagagctgaagctggtggttcccacc
ttgcattctgaactcacggtggcagctgcagtcctggtgctgttggtgattgtgatcatc
tcactgattgtcctggttgtcatttggaaacagaaaccgaggtatgaaattcgctggagg
gtcattgaatcaatcagccctgatggacatgaatatatttatgtggacccaatgcaactg
ccttatgactccagatgggaatttccaagagatggactagtgcttggtcgcatcctggga
tctggtgcctttgggaaagtggtggagggaacagcatacgggctaagccgctcccagcct
gttatgaaggtggctgtgaagatgctcaaacccacagccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgactcacctgggaccacatttaaacattgtgaacttg
ctgggagcctgcaccaagtcaggccccatttacatcatcactgaatactgcttctatgga
gatttggtcaactatttgcataagaatagggatagcttcctgagtcagcacccggagaag
cctaagaaagaattggacatctttggattgaaccctgcagatgaaagcacaaggagctat
gtgattttatcttttgaaaacaatggtgactatatggacatgaagcaagctgatgccaca
cagtacgtccccatgctagaaaggaaggaggtttctaaatattcggatatccagagatcg
ctctatgatcgtcctgtctcatataagaagaaatctatgctagattcagaagtcaaaaac
ctcctctcggatgataactctgaaggccttactttgttggatttgttgagctttacctat
caagttgcccgaggaatggaatttttggcatcaaaaaactgtgtccaccgcgacctggct
gctcgcaatgtcctcctggcgcaagggaaaatcgtgaagatctgtgactttggcttggct
cgagacatcatgcatgattcgaactatgtgtcaaaaggcagtaccttcttgcccgtgaag
tggatggctcctgagagcatcttcgacaacctctacaccaccctaagtgacgtctggtct
tacggcattctgctctgggagatcttttctcttggtggcacaccctaccctggcatgatg
gtggattctactttctacaacaagatcaagagtgggtaccggatggccaagcctgaccat
gccaccagtgaagtctatgacatcatgatgcagtgctggaacagcgagccagagaagaga
ccctccttttaccacctgagtgagattgtggagagcctgctgccaggacaatacaaaaag
agttatgagaaaatccacttggacttcctgaagagtgaccatcctgctgtggcccgcatg
cgcgtggactcagacaacacatatattggtgtcatctacaaaaatgaggaagacaagctg
aaagactgggagggtggcctggatgagcagagactgagcgctgacagtggctatatcatc
ccgctgcccgacatcgatcctgtgcctgaggaggaagacctgggcaagaggaacaggcac
agctcacagacctctgaagaaagtgccattgagacaggttccagcagttccaccttcatc
aagagagaggacgagaccattgaggacatcgacatgatggatgacattggcatagactcc
tcagacctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system