KEGG   Heterocephalus glaber (naked mole rat): 101697591Help
Entry
101697591         CDS       T02812                                 

Gene name
Sdha
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00020  Citrate cycle (TCA cycle)
hgl00190  Oxidative phosphorylation
hgl01100  Metabolic pathways
hgl01200  Carbon metabolism
hgl04714  Thermogenesis
hgl04932  Non-alcoholic fatty liver disease (NAFLD)
hgl05010  Alzheimer disease
hgl05012  Parkinson disease
hgl05016  Huntington disease
Module
hgl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hgl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hgl_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101697591 (Sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101697591 (Sdha)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101697591 (Sdha)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    101697591 (Sdha)
   05012 Parkinson disease
    101697591 (Sdha)
   05016 Huntington disease
    101697591 (Sdha)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101697591 (Sdha)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101697591 (Sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 101697591
NCBI-ProteinID: XP_004845158
UniProt: G5BPG8
LinkDB All DBs
Position
Un
AA seq 665 aa AA seqDB search
MAGVGTVSRFLRARRLALSRAQWPAAFRAQACGFHFSVNGNKRASAKVSNSISTQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACLTKLFPTRSHTVAAQGGINAALGNMEEDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPASVIELENYGMPFSRTEDGRIYQRAFGGQSLK
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECRGVIALCI
EDGSIHRLRAKNTVVATGGYGRTYFSCTSAHTTTGDGTAMITRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSEGERFMERYAPVAKDLASRDIVCRSMTLEIREGRGCGP
EKDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYRG
QVLKHVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESSRPGD
KVPPVKPNAGEESVTNLDKLRFADGSIRTSELRLNMQKTMQNHAAVFRVGSVLQEGCEKI
SQLYGDLKHLKTFDRGMVWNTDLVETLELQNLLLCALQTIYGAEARKESRGAHAREDYKV
RIDEFDYSKPIQGQQKRPFGEHWRKHTLSYVDIKTGKVTLEYRPVIDKTLNEADCSTVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggtcgggaccgtttcgcggtttcttcgcgcgcggcgcttggcgctgtcccga
gcgcagtggccagcagccttccgagcacaggcctgtggctttcacttcagtgtcaacggg
aataagagggcatctgctaaagtttcaaattcaatttcaactcagtacccagtagtggat
cacgaatttgatgcagttgtggtaggcgctggaggggcaggtttgcgagctgcatttggc
ctttctgaggcaggctttaataccgcatgccttacaaagctttttcctactcggtcacac
actgttgcagcacagggaggaatcaatgctgctttggggaacatggaagaggacaactgg
agatggcacttctatgacactgtgaagggctctgactggctgggggaccaggatgccatc
cattacatgacagagcaggcccctgcctccgtgattgagctagaaaattatggcatgcca
tttagcagaaccgaagatgggaggatttaccagcgtgcatttggtgggcagagcctcaag
tttgggaaaggcgggcaggcccaccggtgctgctgtgtggctgatcggactggccactca
ctcctgcacaccttgtatggaaggtctctgcgatacgataccagctattttgtagagtat
tttgccttggatctcttgatggaagatggggaatgtcgtggtgtgattgcactgtgcata
gaagatgggtccatacatcgcctaagagcaaagaacactgttgttgctactggaggctat
gggcggacctacttcagctgcacctctgcccacaccaccactggtgatggcacagccatg
attaccagagctggccttccctgccaggacttggagtttgtgcagttccaccccacaggc
atatatggtgctggttgtctcatcacagaaggatgccgtggagaaggaggcattctcatt
aacagtgagggtgagaggttcatggagagatatgcccccgtcgcgaaggacctggcatcc
cgagatattgtatgtcggtccatgactctggagatccgtgaaggaagaggctgtggccct
gagaaagatcatgtctacctgcagctacaccatctgccccctgagcagctggccacccgc
ttgcctggcatctcagagacagccatgatctttgctggcgtggatgtcaccaaggagcca
atccctgtcctccccaccgtgcattacaacatgggtgggattcccaccaactacaggggg
caggtgctgaagcatgttaatggccaggatcaggttgtgcctggcctctatgcctgtggg
gaggctgcctgtgcctcagtgcatggtgccaacaggcttggggcaaactcccttctggac
ctggtagtctttggacgggcctgtgccctaagcattgcagagtcttccagaccaggagat
aaagttcctccagttaaaccaaatgccggggaagagtctgtcactaatcttgacaagttg
agatttgctgatggaagcataagaacatcagaactgcgtctcaacatgcaaaagacaatg
cagaatcatgctgcagtattccgtgtgggaagcgtgctgcaagaaggctgtgagaaaatc
agccagctctatggagacctgaagcacctgaagacgtttgacagaggaatggtctggaac
acagacctggtggagaccctggagctgcagaacctgttgctctgtgcacttcagaccatc
tatggagcagaggcacggaaggagtcacggggtgcccatgccagggaagattacaaggtg
cggattgatgagtttgattactccaagcccatccaggggcagcagaagaggccatttggg
gagcactggaggaagcacaccctttcctatgtggacatcaagactgggaaggtcaccctg
gaatataggcctgtcatcgacaagaccttaaatgaggctgactgctccacggttccccct
gccattcgctcctactga

DBGET integrated database retrieval system