KEGG   Heterocephalus glaber (naked mole rat): 101698015
Entry
101698015         CDS       T02812                                 

Gene name
Brca2
Definition
(RefSeq) BRCA2, DNA repair associated
  KO
K08775  breast cancer 2 susceptibility protein
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl03440  Homologous recombination
hgl03460  Fanconi anemia pathway
hgl05200  Pathways in cancer
hgl05212  Pancreatic cancer
hgl05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    101698015 (Brca2)
   03460 Fanconi anemia pathway
    101698015 (Brca2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101698015 (Brca2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101698015 (Brca2)
   05224 Breast cancer
    101698015 (Brca2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hgl04121]
    101698015 (Brca2)
   03036 Chromosome and associated proteins [BR:hgl03036]
    101698015 (Brca2)
   03400 DNA repair and recombination proteins [BR:hgl03400]
    101698015 (Brca2)
Ubiquitin system [BR:hgl04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    101698015 (Brca2)
Chromosome and associated proteins [BR:hgl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     101698015 (Brca2)
DNA repair and recombination proteins [BR:hgl03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     101698015 (Brca2)
   FA (Fanconi anemia) pathway
    Downstream FA components
     101698015 (Brca2)
SSDB
Motif
Pfam: BRCA-2_helical BRCA2 BRCA-2_OB3 BRCA-2_OB1 Tower
Other DBs
NCBI-GeneID: 101698015
NCBI-ProteinID: XP_004854821
LinkDB
Position
Un
AA seq 3438 aa
MPIGSKERPTFFENFKTRCSKADLGPISLNWFEELSSEAPPCNSEPAEEPEYKINSYEPN
LFKTPQRKPFYHQLASTPIIFKEQSQTLPLYRSPLNELGKYRLNLGKDIANSELKNHRTV
KAKVDQAKDVASPPLNSCFSESPLVLQCTRVTPRREKPVICGSLCHTPQLIKGQTPKHIS
ESLGAEVDPDMSWSSSLATPPTLSSTVLIVRDEEASETIFPNNTTAILKRSLSNHDENLK
NNDKFIPSVMDNENKNQREVNHHGLGKMVGNSFGKVGCCKDHFVKLMPNALEDEVHETLT
DISEEDSFSLSFLKHRTGNLQKKRMSKTRKKIFHEIRTDDFKEETKKQMKEKKHSFASEM
EPKDSDPLDTNVPSQKPFGSESDRISKEAIPSSGSQWSQLTLSGLNATQMKIPLLPISSC
DQKYSKKYLIDSEKEGGNHTPSENSLPHISSLPEKISNEGKSVDERDEAEHFESHKDSIL
AVKEAISGTSPVSPVFQGIKRSIFKIREPSEETFCTLFSDNVINPNFKEETKASKSGLEI
HTVYSHREDSLCLSSVDNGTLPATIMPSSGTLKNRGLISTLKKKKKKFIYAINDEASCQR
KGMQKEQTRALTNNSAQFQADGFEASLTFANADAGLLHSFVKRNCLQNDAEESTFSTNSS
GANLRKCSNNESNYAITIISQDLNYKEAKLHEEKLQLFIPPETDFLSCLQKRQYGVDSKS
QKVSNIEENVLVAAYQPEVQHSEVEYSGIPLQSQKSFFDGHDNTSPLILSPSSKNPSNPV
MISKEKESHKMSEKLKCKNCETGIELAKNISIEKNQKIYVLNGNSKKVEQLSLEKCITAA
SPSLKMPLNHDTSLTVIQKDQKETSLISEMTANPNSEELFAGSENNFVFQIPDKRNSPVL
GKTKEICGSDFSFIKESILQNSAMVVDTDIDDKQAIQVLITEDFDPSNTIHDLKENRNSV
KQHLTSGLENQKSDISLDMKPNRNNDYTHKWAGILHPGSSHSFGGSFRTASNKEIKVSEH
NIKKSKMLFKDIEEQYPTSSASVEIVNTLLNNQKKLNKPHIFDLQSVETVPTCVQSSPSV
SDCENNHTTSQMLPLKQDFNSNHNLTPSQKAEVTELSTILEESGSQFEFTQFRKASHLIQ
SNTLEVPRNQMTALSTTSEEWKDVDLHPTFGASSIDQIDSIKNVGGIGVKQKFAYLLKNS
PNKSAAGSLTDESKVEFRGFYSGLGTKLNISSEALQKALKLFSDIENISEETSPEVDPSF
SSSKCYDSIVSMFKIENHNNDKNINKKNNNCQLVLQNNIDMTTGIFVEENPESCTRNAEN
KDNKYIGASRNICKLGKSGGSNSSKNDTVYIHRDNLPCNNQHNIHFKLSSQFMSDGSTQL
KESLSDLTCLEVVKAEETSYISSTKEQLTAGEMEQNTNNLNTLFQTASGKNIRVTKESLS
KVVNFFDQKTEEWNDFSDSLNSKLLSGIENKMDISSNGETNTMKNKILEESTPAGTGTQL
SLLQQPECQIENIKEPNLLGFRTASGKKVRIAQESLDKVKNLFDEKQEDVSKITKLSHKA
AKNVKDREDCKEGLELVCETTEITSIPKREETQNSLNNKNFSETGMLPSLTNSLQRQTEN
LKTSNSISLEVKVHGNVEKETVNSPTTCTNQFPFSTIEESLGFFTGHGKKISVNPALLFK
VTKWLKGELDEQQEEINTAEVVCVKEYSQDCVGNPLNKISSSSITTENDKIYLSEKQDLI
HLSNSSISDSYHSDVCHSDNMHDDSGYLSKNKIDSGIESVMNVKDKNNTGFPEVPSIKEV
NTYPQAVSEDICVQKPVTNFSPCKNKNTTINLAVSDSDNIEVRPPAFSTASGKIVLISQD
SIKKVKKIFTENSKKIIHQNTENNNKEINQSTESKSNTSQRKTVTAYNKALDNSEDVIFP
NSLDEEECTHSCKVFAGTQNEGSLQHNKSMSELEKVSERPACVSLKASDICKFNNTGKVP
KSASSTNVYGIFSTARGKSVEISDASLQKARQVFSKTDGSTKQLFSKVFKNNEHSDHFTK
ECTIMHTPKKVSPPKNFQHTADSSAFSGFSTASGKQVSISESALHKVKGMLKEFDLINEY
TLEHSPSSRLDVSKIPLCIDKRTLEHSIDSKMKKTYNNEFKLSSNCKTEIGSSESNHSIK
VSPYRSRFKQDKRHLILGSKASLFENTHLLGEEQALPKNIMEIGKTETFPNNSVQTRAEI
RSPCPKEPENYFETEAVEIAKAFMEDDELTDCEPPSHPKHSLRTCQKNERILLNSRTGKR
RRDALVSAGESQIKRSLLNEFDRIIENEGKSLKASKSTPDGTIKDRKLFTHHISLEPVTC
GPSCTSNKCQEIQNLNFIAPAQELLSKSHLYEHLTLEKSSNSYPVSRQPFYNVPTLRNEK
MKYPITTGKSTKVFVPPFKTKSCFHRDEYCVSKDINLEANKQKQKNIDEYGSGDSENNVN
DSEIHQFNKNSSNQATDIIFTKCKEEPSDLMTSLQKAREIQDIRIKKKERQHIFPQPGSL
YLAKTSTLPRISLKAAVGGRVPSACSHKQLYMYGISKHCMKINSKNAGSFQFHTQDYFGK
EDLQAGKGIQLADGGWLIPTNDGKAGKEEFYRALCDTPGVNPKLISRVWVYNHYRWIIWK
LAAMEFSFPQEFANRCLNPERVLLQLKYRYDMEVDRNRRSSLKKIMERDDTAAKTLVLCV
SDIVSSNTNTSETSSNKTSGADTKKVAAIELTDGWYAVKAQLDPPLLAFLKNGRLGVGQK
IIIHGAELVGSPDACTPLEAPDSLMLKVSANSTRPACWYTKLGFFPDPRPFPLPLSSLFS
DGGNVGCADVVVQRIYPIQWMEKTSSGLYIFRNEREEEKEAAKHAEAQQKKLEVLFTKIQ
GQFEEHEEKPTKWCTLSHTASREEVCALQGGAELYEAVRNAPDPDYLEGYFSAEQVRALN
NYRKMLNDKRQAQIQLEFRKAMESAEQGEQGLSRNVTTVLKLRIVSYERKENYSVILSIW
RPSSDLYSLLTEGKRYRIYHLAASKSKSKYERANIQLTATKKTQYQQLTASNEILFQIYH
PREALCFNRLLDPDFQPSCSEVDLIGFVVSVVKKIGLAPLVYLTDEWHNFLAIKFWIDIN
EDIIKPHMLITASNLQWRPESKFGIPTLFAVDFSMFSASPKGGHFQERFNKMKNVVENID
IFCNDAEKKLTHLLNVNDPKWSTPSKDYTSEPHTAQTVLGTGNKCLMSSPSNEINYQSPL
SLCSPKGKSVSTPISAKITSKSSEGEKSMNDPKNCKKRRALDFLSRVPLPPPMSPICTFV
SPAAQKAFQPPRICGTKYETPIKKKELNFPQMTPLKKANEVSLLESNSIPDEEFAMINTQ
ALLNSSSGENQPLSISESTRTAPSSSENYLGQKSHYTMSLVKGQENSQASAEECKSNMQD
TSRIKNISKRLQRRQKHK
NT seq 10317 nt   +upstreamnt  +downstreamnt
atgcctattggatccaaagagagaccaactttttttgaaaattttaagacgcgatgcagc
aaagcagatttaggaccaataagccttaattggtttgaagaactttcatcagaggctcca
ccctgtaattctgaacctgcagaagaacctgaatataaaatcaacagttatgagccaaat
ctatttaaaacaccacaaaggaaacccttttatcatcagttagcttcaactccaataata
ttcaaagagcaaagtcaaactctaccactataccggtctcctttaaatgaattaggtaaa
tacagattaaacttgggaaaggatattgccaatagtgaacttaaaaatcatcgcacagtg
aaggctaaagtggaccaagcaaaagatgttgccagtccacctctaaattcttgtttcagt
gaaagtcctctcgttctacagtgtacacgggtaacaccacgaagagaaaagccagtaata
tgtggaagtttatgtcacacaccccagcttataaagggtcagacaccaaaacatatttct
gaaagtctaggagctgaggtggatcctgatatgtcttggtcaagttctttagctacgcca
ccgactctcagttctactgtgctcatagtcagagatgaggaagcatctgaaactatattt
cctaacaataccactgctattttgaagcgctctttgtctaaccatgatgaaaatctgaaa
aacaatgataaatttatcccttctgtgatggacaatgaaaacaaaaatcaaagagaagtt
aaccatcatggattggggaaaatggtagggaattcatttggaaaagtaggttgctgcaaa
gatcactttgtaaagttaatgccaaatgccctagaagatgaagtacatgaaacacttaca
gacatttctgaagaagatagtttttcactatcttttttgaagcatagaacaggaaatcta
caaaaaaaaagaatgagcaaaactaggaaaaaaattttccatgaaataagaacagatgac
ttcaaagaagaaactaaaaaacaaatgaaagaaaaaaaacattcatttgcatctgaaatg
gaaccaaaagatagtgatcctttagatacaaatgtaccaagtcagaagccttttggcagt
gaaagtgacagaatctccaaggaagccataccatcttcaggctctcaatggtctcagcta
acactctcaggtctaaatgcaacccagatgaaaatacctctactgcctatttcttcttgt
gaccaaaagtattctaaaaaatacttaatagatagtgaaaaagaaggtggaaaccatact
ccttcagaaaattctttgccacatatttctagtctaccagaaaagatatcaaatgaggga
aaatctgtagatgagagagatgaagcggaacattttgaatctcataaagactccattctt
gcagtgaaagaggcaatatctgggacttctccagtatctcctgtatttcaaggtatcaaa
aggtctatattcaagataagagaaccatctgaagagactttttgtacactcttctcagat
aatgtgatcaacccaaactttaaagaagaaactaaagcctctaaaagtgggttggaaata
catactgtttactcacacagagaggattctttatgtctgagttcagttgataatggaacc
ttgccagccactatcatgccttcttctgggactttaaagaatagaggtttaatatccact
ttgaaaaagaaaaaaaaaaagtttatttatgctataaatgatgaagcatcctgtcaaaga
aagggaatgcagaaagaacaaacaagagcactaaccaacaattcagcccagtttcaagca
gatggttttgaagcatcacttacatttgcaaatgctgatgcaggtttattgcattctttt
gtcaaacgaaactgtttacagaatgatgctgaagagtcaaccttttcaaccaactcttct
ggggcaaatctgagaaaatgttccaataatgaaagtaattatgctattacaataatatct
caagatcttaattacaaagaagcaaaacttcatgaagaaaaactgcagttatttataccc
ccagaaacggattttctgtcgtgcctacagaaaagacagtatggagtagattcaaaaagc
cagaaagtttcaaatatagaagaaaatgtcttagttgcagcatatcagcctgaagttcag
cattcagaagtagaatatagtggtattccacttcagtcacagaaaagcttttttgatggc
catgataatactagccctcttatattatctcctagctccaagaatccttcaaatccagtt
atgatctctaaagaaaaagaatcacacaaaatgtcagagaaactaaaatgtaagaattgt
gaaactggtattgaattagccaaaaatatttccattgaaaaaaatcaaaaaatatatgtt
ttaaatggaaattctaaaaaagttgagcagttgtcacttgaaaaatgcataacagcagca
tcgccttcactgaagatgccactcaaccatgatacaagtctaacagtgatccaaaaagat
caaaaagaaacttctttaatttcagaaatgactgccaatccaaactctgaagaacttttc
gcaggcagtgagaataattttgtctttcaaatacctgataaaaggaatagtcctgtttta
ggaaagactaaggaaatttgtggatcagattttagttttataaaagaatccattctccag
aactctgctatggtagtagatacagacatagatgacaaacaagcaatccaggtgctgatt
actgaagattttgacccatcaaatacaatccatgatctcaaagagaacagaaatagcgta
aagcagcatctaacttcaggacttgaaaatcagaaatcagacatctccttggatatgaaa
ccaaacaggaataatgattacacacacaaatgggcagggatcttacatccaggttcgagt
cacagttttggaggtagcttcagaacagcttccaataaagaaataaaagtctctgaacat
aatattaagaaaagcaaaatgcttttcaaagatattgaagaacagtatcctactagttca
gcttctgttgaaattgtaaataccttattaaataaccaaaagaaattaaacaaacctcat
atatttgatttgcaatcagttgaaacagtgcctacatgcgtgcagagtagtccgtctgtt
tctgattgtgaaaataaccacacaacctcccagatgttaccattaaaacaagattttaat
tcaaaccataatttaacacctagccaaaaggcagaagttacagaactttctactatatta
gaagaatcaggaagtcagtttgaatttacacagttcagaaaagcaagccacttaatacaa
agtaatacacttgaagtgcctagaaaccagatgactgccttaagtaccacttctgaggaa
tggaaagatgttgatcttcatcccacatttggtgcctcatctattgatcagatagacagc
atcaaaaatgttggaggaattggagttaaacaaaagtttgcttacttattgaaaaacagt
cctaacaaaagtgctgctggttctttgacagatgaaagtaaagtggaatttagaggtttt
tattctggtcttggcacaaaactgaatatttctagtgaagccctacagaaagccttaaaa
ctgttcagtgacattgagaatattagtgaagagacttctccagaagtagatccaagtttc
tcttcaagtaaatgttatgattctattgtctcaatgtttaagatagaaaatcataacaat
gataaaaatataaataagaaaaacaataattgccaactagtattacaaaataatattgac
atgactactggcatttttgttgaagaaaatcctgaaagttgcacgagaaatgcagaaaat
aaagataacaaatatattggtgccagtagaaatatttgtaaattaggaaaatcgggtggc
agcaattcaagtaaaaatgatacagtttatattcatagagataatttgccatgtaacaat
cagcacaatatacattttaaattatctagccagtttatgagtgatggaagcacacaactt
aaagaaagtttgtcagatttaacttgtctggaagttgtgaaggctgaagaaacaagttat
attagttcaactaaagaacagttaactgcaggtgagatggaacaaaatacaaacaattta
aatacactctttcagactgcaagtgggaaaaatatcagagtcaccaaagagtcattaagt
aaagttgtaaatttctttgatcagaaaacagaagaatggaatgacttttcagattctctg
aattctaaattactttctggcatagagaacaaaatggacatttcaagtaatggggaaaca
aacacgatgaaaaacaaaatattggaagaaagtaccccggctggtactggaactcagtta
agtctcctgcaacaacctgaatgtcaaatagaaaatatcaaagaacctaacctgttgggt
tttcgtacagctagtgggaaaaaagtaagaattgcacaagaatctttggacaaagtgaaa
aatctttttgatgaaaaacaggaagatgttagtaaaattaccaaattgagtcacaaagca
gcaaagaatgtcaaagacagagaggactgtaaagaagggcttgaattagtatgtgaaaca
actgaaataacctctatcccaaagcgtgaagaaacgcagaattccctaaataataaaaac
tttagtgaaactggtatgctacccagcctaactaatagcttacaaagacaaactgaaaat
ctcaaaacatcaaatagtatctctttggaagttaaagtacatggaaatgtagaaaaagaa
acagtgaacagccctacaacttgcacaaatcagtttcctttttcaactattgaagaatct
ttaggatttttcacaggacatggtaaaaaaatttctgtgaatccagctttactgtttaaa
gtgacaaagtggcttaaaggagaattggatgagcagcaagaagaaataaatactgctgag
gtagtatgtgtaaaagaatattctcaggattgtgtaggaaatcctttgaataaaattagt
tcaagcagtatcacaactgaaaatgacaaaatttatctctctgaaaaacaagatttaatt
catttgagtaacagtagcatatctgatagctaccattctgatgtttgtcattctgataat
atgcatgatgattcaggatatctctcaaaaaataaaattgattctggtattgagtcagtc
atgaatgtcaaagataaaaataacactggttttccagaagttcccagtataaaagaagta
aacacatatccacaagccgtaagtgaagatatttgtgttcagaaacctgtgactaacttt
tcaccatgcaaaaataaaaatacaaccattaacttggctgtatctgattcagataatatt
gaggtaaggccaccggcattcagtacagccagtggtaaaatagtccttatttcacaagac
tcgattaaaaaagtaaaaaagatatttacggaaaactctaagaagataattcaccaaaac
actgagaataacaataaggaaattaaccaaagcactgagagtaaatcaaacacttcccaa
agaaaaactgtgacagcttataataaggcattggataattcagaggatgttatttttcct
aactctctagatgaggaagaatgtacacattcatgtaaggtttttgctggtactcaaaat
gaaggaagtttgcaacataacaaaagtatgtctgaattggagaaagtttctgaaagacca
gcttgtgttagcttgaaagcttcagatatatgtaaatttaataatacagggaaggttccc
aagtcagcctcttctacaaatgtttatgggatttttagtacagcaaggggaaaatctgta
gaaatatcagatgcttcattacaaaaggcaagacaggtgttttctaaaacagatggtagt
acaaagcaactcttttccaaagtatttaaaaataatgaacattcagaccatttcacaaaa
gaatgtactataatgcatacccccaaaaaagtatcaccgccaaaaaactttcagcatact
gcagattcatctgctttttctggatttagcacagcaagtggaaaacaggtttcaatttca
gaaagtgccttacacaaagttaagggaatgttaaaggaatttgatttaataaatgaatat
actcttgagcattcaccttcatctagactagatgtatcgaaaattccactttgtattgat
aaaagaaccctggaacactctatagattctaaaatgaaaaaaacctacaataatgaattt
aaattatcgagtaactgtaaaactgaaattggttcatcagaaagtaatcactctattaaa
gtttctccatatcgctctcggtttaagcaagacaaacgacacttgatattaggatccaaa
gcatcactttttgagaacacgcatcttttgggggaagaacaggctttacccaaaaatata
atggaaattggtaaaactgaaacttttcctaataattctgtgcaaacaagggcagaaata
cgttctccttgccccaaagaaccagaaaactattttgaaacagaagcagtagagattgct
aaagcttttatggaagatgatgagctgactgattgtgaaccaccaagtcatcccaaacac
tcacttcgtacatgccaaaaaaatgaaaggattttgttaaattcaagaactggaaaaagg
agaagagatgcccttgtttcagctggagaatctcaaattaaaagaagcttgttaaatgaa
tttgacaggataatagaaaatgaaggaaaatccttaaaagcttcgaaaagcactcctgat
ggtacaataaaagatagaaagctgtttacacatcacatttctttagagccagttacctgt
ggaccctcttgcacaagtaacaagtgtcaagaaatccagaatctaaattttattgcacct
gctcaagaacttctgtctaaatctcatctttatgaacacttgactttggaaaaatcttca
aacagttacccagtttcaagacagccattttataatgttcctactctaagaaatgaaaaa
atgaaatacccaattactacaggcaaatcaaccaaagtctttgttccacctttcaaaact
aaatcatgttttcacagagatgaatattgtgtgagcaaggatattaatttagaggcaaac
aaacagaagcaaaaaaatatagatgaatatggctctggtgatagtgaaaataatgttaat
gatagtgagattcatcagtttaacaaaaacagctccaatcaagcaacagacataattttc
acaaagtgtaaagaagaaccttcagatttaatgacaagccttcagaaagccagagaaata
caggatattcgaattaaaaaaaaagaaaggcagcatatttttccacaaccaggtagtctg
taccttgcaaaaacatccactctgcctcgaatctctctgaaggcagcagttggaggccga
gttccctctgcatgttctcataaacagctctatatgtatggcatatctaaacattgcatg
aaaattaacagcaaaaatgcaggatcttttcaatttcacactcaggattactttggtaag
gaagatttacaggctggaaagggaatacagttggctgatggtggatggcttatacctacc
aatgatggaaaggctggtaaagaggaattttatagggctctgtgtgacaccccaggtgtg
aatccaaagcttatttctagagtttgggtctataatcactacagatggattatatggaaa
ctggcagctatggaattttcttttcctcaggaatttgctaatagatgcctaaacccagaa
agggtccttcttcaactaaaatacagatatgacatggaagttgatagaaacagaagatca
tctttaaaaaagataatggaaagggatgatacagctgcaaaaacacttgttctctgtgtt
tctgacattgtttcatcgaacacaaatacatctgaaacttctagcaataaaaccagtggt
gcagataccaaaaaagtggccgctatcgaacttacagatggatggtatgctgtcaaggcc
cagctggaccctcctctcttagctttcttaaagaacggaaggctgggtgtgggtcagaag
atcattatccacggagcagaactggtgggctctcctgatgcctgtacacctcttgaagcc
ccagactctcttatgttaaaggtttcagctaacagtactaggcctgcttgctggtacacc
aagctggggttctttcctgaccctaggcctttccctctgcctctgtcatcactgttcagc
gatggaggaaatgttggttgtgctgatgtcgttgttcaaagaatataccctatacagtgg
atggagaagacatcatctggattatatatatttcgcaatgaaagagaagaagaaaaggaa
gcagcaaaacatgcagaggcccaacaaaagaaactagaagtcttattcactaaaattcaa
ggacagtttgaagagcatgaagaaaaacctacaaaatggtgtacactctcacacacagca
tcaagagaggaggtctgtgctctgcagggtggtgcagagctttatgaagcagtgaggaat
gcaccagacccggattaccttgagggttatttcagtgcagagcaagtaagagccttgaac
aattacagaaaaatgttgaatgataaaagacaagcacagatccagctggagttcaggaag
gctatggaatctgctgaacagggggaacaaggtctgtcaaggaatgtcacaactgtgttg
aagttgcgcattgtaagctatgagagaaaagaaaattattcagttatattgagtatttgg
cgaccatcatcagatttatattccctcttaacagagggaaagagatacagaatctatcat
cttgcagcatcaaaatctaaaagtaaatacgaaagagcaaacatacagttaacagcaaca
aaaaaaactcagtaccaacagctaacggcttcaaatgaaatcttattccagatttatcac
ccaagggaggccctttgcttcaacagactattagatccagactttcagccatcttgttct
gaagtggacctcataggatttgtagtttctgttgtgaaaaaaataggtcttgctccactg
gtctatttgacagatgaatggcataattttttagcaataaaattttggatagatattaat
gaagatattattaaacctcacatgttaattactgcaagcaacctccagtggcgaccagaa
tccaaatttggaattcctactttatttgctgtggatttttccatgttttctgccagccca
aaagggggccactttcaagagagattcaacaaaatgaaaaatgttgttgagaatattgac
atattttgcaatgatgcagaaaagaagctcacacatttacttaatgtaaatgatcccaag
tggtccaccccatctaaagactatacatcagaaccacacactgctcagacagtccttggt
acaggaaacaagtgtctgatgtcctctcctagtaatgagataaattaccagagtccttta
tcactttgttcaccaaaagggaagtctgtgtccacacccatatcagccaaaataacttca
aagtcttctgagggagagaaatcaatgaatgacccaaaaaactgcaaaaaaagaagagcc
ctggattttctgagtcgcgtgcctttacctccacctatgagtcccatttgcacatttgtt
tccccagctgcacagaaggcctttcagccaccacggatttgtggcaccaagtatgaaaca
cctataaagaaaaaggaattgaattttcctcagatgactccacttaaaaaagccaatgaa
gtttctcttttggaaagcaattcaatacctgatgaagaatttgcaatgataaatacccaa
gccctcctgaatagttcttcaggagaaaatcaacctctgtctatcagtgaatccaccagg
actgctccttccagttcagaaaattatcttggacagaaaagtcattatactatgtctctg
gtcaaagggcaagagaattcacaagccagcgcagaagaatgtaagagcaacatgcaggac
acaagtaggataaagaatatatctaagagattgcaaaggcgacaaaaacataaataa

DBGET integrated database retrieval system