KEGG   Heterocephalus glaber (naked mole rat): 101698281Help
Entry
101698281         CDS       T02812                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B17
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00040  Pentose and glucuronate interconversions
hgl00053  Ascorbate and aldarate metabolism
hgl00140  Steroid hormone biosynthesis
hgl00830  Retinol metabolism
hgl00860  Porphyrin and chlorophyll metabolism
hgl00980  Metabolism of xenobiotics by cytochrome P450
hgl00982  Drug metabolism - cytochrome P450
hgl00983  Drug metabolism - other enzymes
hgl01100  Metabolic pathways
hgl05204  Chemical carcinogenesis
Module
hgl_M00014  Glucuronate pathway (uronate pathway)
hgl_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101698281
   00053 Ascorbate and aldarate metabolism
    101698281
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    101698281
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101698281
   00860 Porphyrin and chlorophyll metabolism
    101698281
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101698281
   00982 Drug metabolism - cytochrome P450
    101698281
   00983 Drug metabolism - other enzymes
    101698281
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    101698281
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hgl01003]
    101698281
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101698281
Glycosyltransferases [BR:hgl01003]
 Others
  Hydrophobic molecule
   101698281
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 101698281
NCBI-ProteinID: XP_004875373
UniProt: G5BZ78
LinkDB All DBs
Position
Un
AA seq 530 aa AA seqDB search
MFMKWISSLLLLQMSCYFNSGSCGKVLVWPTEYSHWMNMKNILEELIQRRHEVTVLRPSN
YIFVDVNSSSGIKFETFTASINRDEWEKYFIQLVTRWINIGPIDSCIPYFSELENMFKEF
FDTWQHLCKEIVSNKILMKKLQESRFDVLLSDPISPCGELVAELLKIPFVYTLRFSPGFQ
LEKFAGGLTLPPSYVPVVMSRLSGQMTFMERVKNMICMLYFDFWFDTFNEKKWNQLYSEV
LGKPTTLYKTMAKAEMWLIRSYWDLEFPHPTLPNFDFVGGLHCKPAKPLPNEMEEFVQSS
GEHGVVVFSLGSMVSNMTKERANMIASALAQIPQKVLWRFDGKKPDILGPNTRLYEWLPQ
NDLLGHPKTRAFVTHGGANGIYEAIYHGIPMVGIPLFGEQHDNIAHMMAKGVAVKVEFIT
LSSTELLNALETVLNNLTYKENAMWLSTIHHDQPMKPLDRAVFWIEFVMHHKGAKHLRPL
AQNLTWYQYHSLDVIGFLLSCVATITFLAIKCCLFCSQKFVKKGKKQKRE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttcatgaaatggatctcatctctgctgctgctacaaatgagttgttatttcaactct
ggaagttgtggaaaagtgctggtatggcccacggaatacagccactggatgaatatgaag
aatatactagaggaacttatccagaggagacatgaggtgacagttctgagaccttcaaat
tacatttttgttgatgttaattcatcttctggaattaaatttgaaacttttactgcatct
atcaatagagatgaatgggaaaaatacttcattcagcttgtcactaggtggattaatatt
ggaccaatagattcatgtattccatatttttcagaattagaaaacatgtttaaagaattt
tttgatacttggcaacatttatgtaaagaaatagtctcaaataagatacttatgaaaaaa
ctccaagaatcaagatttgatgtccttctttcagatcccattagtccctgtggtgagctg
gtggctgagctactaaaaataccatttgtgtacactctccggttctctcctggcttccaa
ctggaaaaatttgcaggaggccttacccttcctccttcttatgtacctgttgtaatgtca
agactaagtggtcaaatgactttcatggaaagggtaaaaaacatgatatgtatgctttat
tttgacttttggtttgatacatttaatgagaaaaagtggaatcagctttacagtgaagtt
ttaggaaaacccactacattatataagacaatggcaaaggcagaaatgtggctcattcga
agctactgggatttggaattccctcaccccaccttaccaaattttgattttgttggagga
ctccattgcaaacctgccaaacctctacctaacgaaatggaagaatttgtgcagagctct
ggagaacatggtgttgtggtgttttctctggggtccatggtcagtaacatgacaaaagaa
agggccaatatgattgcctcagcccttgcacagattccacaaaaggttctttggagattt
gatggcaagaaaccagatatcttaggacccaacactcgtttgtatgagtggctccctcag
aatgacctacttggtcatccaaaaaccagagcttttgtcactcatggtggagccaacggt
atttatgaggcaatctaccacggaatccctatggtgggcattcctttgtttggggaacaa
catgataacattgctcacatgatggctaaaggagtagctgttaaagtggaattcataaca
ttatcaagtacggaattgctaaatgcactggagacagtccttaacaaccttacctataag
gagaatgctatgtggttgtccaccattcaccatgatcagcccatgaagcccctggacaga
gcagtcttctggattgagtttgtcatgcaccacaaaggggccaagcacttgcggccactt
gcccaaaacctcacctggtaccagtaccactcactggatgtgattgggttcctactgtct
tgtgtggcaaccattactttccttgccataaaatgttgcttgttttgttctcaaaaattt
gtgaagaagggaaagaagcaaaagagagagtag

KEGG   Heterocephalus glaber (naked mole rat): 101707823Help
Entry
101707823         CDS       T02812                                 

Gene name
Ugt1a6
Definition
(RefSeq) UDP-glucuronosyltransferase 1-6
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00040  Pentose and glucuronate interconversions
hgl00053  Ascorbate and aldarate metabolism
hgl00140  Steroid hormone biosynthesis
hgl00830  Retinol metabolism
hgl00860  Porphyrin and chlorophyll metabolism
hgl00980  Metabolism of xenobiotics by cytochrome P450
hgl00982  Drug metabolism - cytochrome P450
hgl00983  Drug metabolism - other enzymes
hgl01100  Metabolic pathways
hgl05204  Chemical carcinogenesis
Module
hgl_M00014  Glucuronate pathway (uronate pathway)
hgl_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101707823 (Ugt1a6)
   00053 Ascorbate and aldarate metabolism
    101707823 (Ugt1a6)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    101707823 (Ugt1a6)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101707823 (Ugt1a6)
   00860 Porphyrin and chlorophyll metabolism
    101707823 (Ugt1a6)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101707823 (Ugt1a6)
   00982 Drug metabolism - cytochrome P450
    101707823 (Ugt1a6)
   00983 Drug metabolism - other enzymes
    101707823 (Ugt1a6)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    101707823 (Ugt1a6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hgl01003]
    101707823 (Ugt1a6)
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101707823 (Ugt1a6)
Glycosyltransferases [BR:hgl01003]
 Others
  Hydrophobic molecule
   101707823 (Ugt1a6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Zemlya Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 101707823
NCBI-ProteinID: XP_004868417
LinkDB All DBs
Position
Un
AA seq 533 aa AA seqDB search
MATALQAPLGGLVRLLLLVCVMSWAECGKVLVVPMEGSHWLSMKDVVRKLHAAGHQAEVL
APEVTVHVKGEDFFTLKTYTFPYSEEEYNHLMLSLIKLTFETQNFLKTFLKMMEIFTNVS
ETYERSCVEMLHDHSLIRQLNSSSFDVVLTDPVFPCGAILAKYLHIPAVFFLRGLPCSLD
FAGSQCPNPSSYIPQLLTTYSDHMSFLQRVKNMLYPLALNLFCSTVFGPYPRIASELFQR
EVSLVDVLSHASLWLFRGDFVLDYPRPIMPNMVFIGGINCVSRKPLSQEFEGYVNASGEH
GIVVFSLGSMISDIPEKKAMAIAEGLGKVPQTVLWRYTGTPPSNLAKNTILVKWLPQNDL
LGHPKTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTS
DDLANALKKVIYDKSYKENILRLSTLHKDRPIEPLDLAVFWVEFVMRHKGAPHLRPAAHD
LTWYQYHSLDVIGFLLAITLSVSFITLKCCAYGFRKCFGKKEHVKKTPKSKTH
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggccacagcactgcaggcgcctctgggagggctggtgaggctgcttctcttggtgtgt
gtgatgtcgtgggctgagtgtgggaaggtgctggtggtccccatggagggcagccactgg
ctcagcatgaaggacgttgtgaggaagctccatgctgcaggacaccaggctgaggtcctg
gccccagaagtcacagtgcacgtgaaaggagaggacttcttcaccctgaaaacctacact
ttcccctacagcgaggaagaatacaatcaccttatgttgagcctcattaaattgacattt
gaaacacagaattttctgaagacatttttaaaaatgatggaaatcttcacaaatgtttca
gagacctatgagaggtcttgtgtggagatgttgcatgaccattcgctgatcagacaacta
aattccagctcctttgatgtggttttaacggaccctgtttttccttgtggggcaatactg
gctaagtatctgcatattcctgctgtctttttcctgcggggcttgccatgtagccttgac
tttgctggctcacagtgccccaacccttcttcctatattcctcagttgctcacaacatac
tctgaccatatgagtttcctgcagagagtcaagaacatgctctatcctctggccttgaac
ttgttttgcagcaccgtttttgggccttacccaaggatcgcctctgagctgttccagaga
gaagtgtctctggtggatgttctcagccatgcttccttgtggctgttcagaggggacttt
gtgttggactaccccaggcccatcatgcccaacatggtcttcatcgggggcatcaactgt
gtcagcaggaagccgctctcacaggaatttgaaggttatgttaatgcttctggagaacat
ggaattgtggttttctctttgggatccatgatttcagacattccggaaaagaaagctatg
gccattgctgagggtttgggcaaagttcctcaaacggtcctgtggcgctacactggaact
ccaccatcaaatcttgcaaagaatacgatccttgtgaagtggttaccccagaatgatctg
cttggtcacccaaagacccgggcgtttatcacacattctggctcccacggtatctatgaa
ggaatatgcaatggtgtccccatggtcatgatgcccttgtttggggatcagatggacaat
gcaaagcgcatggagacacggggagctggtgtgaccttgaatgtccttgaaatgacttct
gatgatttagcaaatgctctaaaaaaggtcatctatgacaaaagctacaaggagaacatc
ctgcgcctctccaccctgcacaaggaccgacccatagagccactggacctggctgtgttc
tgggtggaattcgtgatgaggcacaagggggcgccacacctgcgccctgcagcccacgac
ctcacctggtaccagtaccactccttggacgtgatcggcttcctcctggccattacgctg
tctgtgtccttcatcaccctcaagtgttgcgcctatggcttccggaaatgctttgggaaa
aaggagcatgtgaagaaaaccccaaaatccaagacacattga

KEGG   Heterocephalus glaber (naked mole rat): 101708308Help
Entry
101708308         CDS       T02812                                 

Gene name
Ugt2b10
Definition
(RefSeq) UDP-glucuronosyltransferase 2B10
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00040  Pentose and glucuronate interconversions
hgl00053  Ascorbate and aldarate metabolism
hgl00140  Steroid hormone biosynthesis
hgl00830  Retinol metabolism
hgl00860  Porphyrin and chlorophyll metabolism
hgl00980  Metabolism of xenobiotics by cytochrome P450
hgl00982  Drug metabolism - cytochrome P450
hgl00983  Drug metabolism - other enzymes
hgl01100  Metabolic pathways
hgl05204  Chemical carcinogenesis
Module
hgl_M00014  Glucuronate pathway (uronate pathway)
hgl_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101708308 (Ugt2b10)
   00053 Ascorbate and aldarate metabolism
    101708308 (Ugt2b10)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    101708308 (Ugt2b10)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101708308 (Ugt2b10)
   00860 Porphyrin and chlorophyll metabolism
    101708308 (Ugt2b10)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101708308 (Ugt2b10)
   00982 Drug metabolism - cytochrome P450
    101708308 (Ugt2b10)
   00983 Drug metabolism - other enzymes
    101708308 (Ugt2b10)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    101708308 (Ugt2b10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hgl01003]
    101708308 (Ugt2b10)
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101708308 (Ugt2b10)
Glycosyltransferases [BR:hgl01003]
 Others
  Hydrophobic molecule
   101708308 (Ugt2b10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C DUF1500
Motif
Other DBs
NCBI-GeneID: 101708308
NCBI-ProteinID: XP_012929376
LinkDB All DBs
Position
Un
AA seq 214 aa AA seqDB search
MDMDHTLNEQPRLVFLPLKVICRFDGKKPDTLGPNAQLYKWISQNDLLSHPKTKAFITYG
GTNGIYEAIYHWVPMVGIPLFYDQPDNIVHMKTKEAALKLDFITMTSTDLLNALKTVIDD
RSYKENTMRLSRIHHDHPVKPLDWAVFWIXFVMHHKGAKHLQVAAHDLSLFQYHSLDVTG
LLLACVATVMFILTKCCLYYCQKFTKTGKKKKRG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggacatggaccacactcttaatgagcaaccaagactggttttcttacccttaaaggtg
atatgcagatttgatggcaagaaaccagataccctaggacccaatgctcagctgtacaaa
tggatctctcagaatgaccttctcagtcatccaaaaaccaaagcttttataacttatggt
ggaacaaatggcatctatgaggcgatctaccattgggtccctatggtgggcattcctctg
ttttatgatcaaccagataacatcgttcacatgaagaccaaggaagcagctcttaaattg
gatttcatcacaatgacaagtacagatttgctcaatgcattgaagaccgtgattgatgat
cgtagctacaaagagaacaccatgaggttatcaagaattcaccatgaccacccagtgaag
cctctggattgggcagtcttctggatctagtttgtcatgcaccacaaaggtgccaagcac
cttcaggttgcagcccatgacctgtccttgttccagtaccactctttggatgtgactggg
ctcctgctggcctgtgtggccactgtgatgttcattctcactaaatgttgtctatattat
tgccaaaaatttacaaaaactggaaagaagaaaaaaagggggtag

KEGG   Heterocephalus glaber (naked mole rat): 101710483Help
Entry
101710483         CDS       T02812                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 1-1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00040  Pentose and glucuronate interconversions
hgl00053  Ascorbate and aldarate metabolism
hgl00140  Steroid hormone biosynthesis
hgl00830  Retinol metabolism
hgl00860  Porphyrin and chlorophyll metabolism
hgl00980  Metabolism of xenobiotics by cytochrome P450
hgl00982  Drug metabolism - cytochrome P450
hgl00983  Drug metabolism - other enzymes
hgl01100  Metabolic pathways
hgl05204  Chemical carcinogenesis
Module
hgl_M00014  Glucuronate pathway (uronate pathway)
hgl_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101710483
   00053 Ascorbate and aldarate metabolism
    101710483
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    101710483
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101710483
   00860 Porphyrin and chlorophyll metabolism
    101710483
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101710483
   00982 Drug metabolism - cytochrome P450
    101710483
   00983 Drug metabolism - other enzymes
    101710483
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    101710483
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hgl01003]
    101710483
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101710483
Glycosyltransferases [BR:hgl01003]
 Others
  Hydrophobic molecule
   101710483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT
Motif
Other DBs
NCBI-GeneID: 101710483
NCBI-ProteinID: XP_004875638
UniProt: G5B0W1
LinkDB All DBs
Position
Un
AA seq 310 aa AA seqDB search
MAMASLRPLLLVLGLLLCVLGPSVSHAGKLLVVPADGSHWLSMLGVIPQLQQNGHEIVVM
APEALLYIKEGSSYTLKTYPVPFQSEDVEASFVELGHDTFGNYPFLQRMIKIYKKVKRDS
AMIFSGCSHLMHNKELMASLVESSFDVVLTDPFFPCGAIVAQYLALPAVFFLNALPCGLH
FEATQCPNPLSYVPRSMSLNPDRMSFPQRVKNVLIALTEKVMCNMVYSPYSLLASEVLQR
DVTIQDLLASASIWLLRTDFVNEYPRPTMPNMAFIGGINCLAKNLLSQVCIRVDFLHACT
LGSSLDEGAF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggccatggcatccctgcgcccacttctgcttgtcctgggcctcctgctgtgtgtgctc
gggccctcagtgtcccatgctgggaagctgttggtggtcccagcagacggcagtcactgg
ctgagcatgctcggagtcatcccgcagctgcagcagaatggacatgaaattgtggtcatg
gcccctgaggccctgttgtacataaaagaaggttcatcttacacattgaagacgtaccct
gtgccattccagagtgaggacgtggaggccagttttgttgaacttggccatgatactttt
gggaactatcctttcctgcagcgtatgattaaaatatacaagaaagtcaaaagggactct
gctatgatcttctctggctgttcccacctcatgcacaacaaggagctgatggcctccctg
gtggaaagcagcttcgatgttgtgttgaccgaccctttcttcccttgtggtgccattgtg
gctcagtacctggctctgcctgctgttttcttcctgaatgcattgccatgtggcctgcac
tttgaagccacccaatgtcccaacccactgtcttatgtgcctaggtctatgtccttgaac
ccagatcgcatgagcttcccacagcgggtgaagaatgtgctcattgccttgacagagaaa
gtcatgtgcaatatggtttattccccctattcgctccttgcttcagaagtccttcagaga
gacgtgactatccaggatcttctggcttctgcatctatctggctgctcagaactgacttt
gtgaatgagtatcccaggcccaccatgcccaatatggcttttattggtgggatcaactgc
cttgccaaaaacctgctctcccaggtgtgtatcagagtggattttttgcatgcctgtact
cttgggagttctttagatgaaggagctttctga

KEGG   Heterocephalus glaber (naked mole rat): 101711049Help
Entry
101711049         CDS       T02812                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B15
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00040  Pentose and glucuronate interconversions
hgl00053  Ascorbate and aldarate metabolism
hgl00140  Steroid hormone biosynthesis
hgl00830  Retinol metabolism
hgl00860  Porphyrin and chlorophyll metabolism
hgl00980  Metabolism of xenobiotics by cytochrome P450
hgl00982  Drug metabolism - cytochrome P450
hgl00983  Drug metabolism - other enzymes
hgl01100  Metabolic pathways
hgl05204  Chemical carcinogenesis
Module
hgl_M00014  Glucuronate pathway (uronate pathway)
hgl_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101711049
   00053 Ascorbate and aldarate metabolism
    101711049
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    101711049
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101711049
   00860 Porphyrin and chlorophyll metabolism
    101711049
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101711049
   00982 Drug metabolism - cytochrome P450
    101711049
   00983 Drug metabolism - other enzymes
    101711049
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    101711049
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hgl01003]
    101711049
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101711049
Glycosyltransferases [BR:hgl01003]
 Others
  Hydrophobic molecule
   101711049
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C
Motif
Other DBs
NCBI-GeneID: 101711049
NCBI-ProteinID: XP_004871770
UniProt: G5BGX5
LinkDB All DBs
Position
Un
AA seq 531 aa AA seqDB search
MMSMKWTSALLLLQMSFYFNSGSCGKVLVWPMDYSHWMNIKNILEELIQRRHEVTVLRPS
SFIFVDINSSSGIKFETFTTSASRDDWEKYFTKWITTWMNLGSISSCFAYFPEVEKIFKE
FSDTWQNLCKETVSNKILMNKLQESRFDVLLADPIAPCGELVAELLKIPFVYTLRASPGF
QLEKFGGGLILPPSYVPVVMSGLGGQMTFMERVKNMICMLYFDFWVEMLNEKKWNQLYSE
VLGKRTTIYDTTAKAEMWLIRSYWDLEFPHPSLPNFDFVGGLHCKPAKPLPKEMEDFVQS
SGEHGVVVFSLGSMVSNMTTERANMIASALAQIPQKVLWRFDGKKPDTLGPNTRLYKWLP
QNDLLGHPNTRAFVTHGGANGIYEAIYHGIPMVGIPLFAEQHDNIAHMKAKGAAVKVEFI
TLSSTELLNALDTVLNNTSYKENAMWLSTIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRP
LAQNLTWYQYHSLDVIGFLLACVATVTFLVIKSCLFCSQKFVKKGKKQKRE
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccatgaaatggacctcagctctgctgctgctacaaatgagtttttatttcaac
tctggaagttgtggaaaggtgcttgtatggccgatggactacagccactggatgaatata
aagaatatactagaggaacttatccagaggagacatgaggtgacagttctgagaccttca
agtttcatttttgttgatattaattcatcatctggaattaaatttgaaacttttactacc
tctgccagtagagatgactgggaaaaatatttcactaagtggatcactacatggatgaat
ttggggtcaataagttcatgttttgcatatttcccagaagtagaaaaaatttttaaagaa
ttttctgatacttggcaaaatttatgtaaagaaacagtctcaaacaagatacttatgaat
aaactccaagaatcaagatttgatgtccttcttgcagatcccattgctccctgtggtgag
ctggtggctgagctactaaaaataccttttgtgtacactctccgggcctctcctggtttc
caactggaaaaatttggaggaggccttatacttcctccttcttatgtacctgttgtaatg
tcaggactaggtggtcaaatgactttcatggaaagggtaaaaaacatgatatgtatgctt
tattttgacttttgggttgaaatgcttaatgagaaaaagtggaatcagctttacagtgaa
gttttaggaaaacgcactacaatatatgacacaactgcaaaggcagaaatgtggctcatt
cgaagctactgggatttggaattccctcaccctagtttaccaaattttgattttgttgga
ggactccattgcaaacctgccaaacctctacctaaggaaatggaagactttgtgcagagc
tctggagaacatggtgtcgtggtgttttctctggggtccatggtcagcaacatgacaaca
gaaagggccaatatgattgcctcagcccttgcacagattccacaaaaggttctttggaga
tttgatggcaagaaaccagataccttaggacccaacactcggttgtacaagtggctccct
caaaatgatctacttggtcatccaaacaccagagcttttgtcactcacggtggagccaat
ggtatttatgaggcaatctaccacggaatccctatggtgggcattcctttgtttgcagaa
caacatgataacattgctcacatgaaggctaaaggagcagctgttaaagtggaattcata
acattatcaagtacagaattgctaaatgcactggacacagtccttaacaacacttcctat
aaggagaatgctatgtggttgtccaccattcaccatgatcagccagtgaagcccttggac
cgagcagtcttctggattgagtttgtcatgcgccacaaaggggccaagcacttgcggcca
cttgcccaaaacctcacctggtaccagtaccactcactggatgtgattgggttcctactg
gcttgtgtggcaaccgttactttccttgtcataaaaagctgcttgttttgttctcaaaag
tttgtgaagaagggaaagaagcaaaagagagagtag

KEGG   Heterocephalus glaber (naked mole rat): 101711920Help
Entry
101711920         CDS       T02812                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B17
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00040  Pentose and glucuronate interconversions
hgl00053  Ascorbate and aldarate metabolism
hgl00140  Steroid hormone biosynthesis
hgl00830  Retinol metabolism
hgl00860  Porphyrin and chlorophyll metabolism
hgl00980  Metabolism of xenobiotics by cytochrome P450
hgl00982  Drug metabolism - cytochrome P450
hgl00983  Drug metabolism - other enzymes
hgl01100  Metabolic pathways
hgl05204  Chemical carcinogenesis
Module
hgl_M00014  Glucuronate pathway (uronate pathway)
hgl_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101711920
   00053 Ascorbate and aldarate metabolism
    101711920
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    101711920
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101711920
   00860 Porphyrin and chlorophyll metabolism
    101711920
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101711920
   00982 Drug metabolism - cytochrome P450
    101711920
   00983 Drug metabolism - other enzymes
    101711920
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    101711920
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hgl01003]
    101711920
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101711920
Glycosyltransferases [BR:hgl01003]
 Others
  Hydrophobic molecule
   101711920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 101711920
NCBI-ProteinID: XP_004871773
LinkDB All DBs
Position
Un
AA seq 532 aa AA seqDB search
MMSMKWISALPLLQMSCYFNSGSCGKVLVWPMDYSHWMNIKNILEELIQRRHEVIVLRPS
SFIFIDANSSSGIKFETLTTSINRDEWGKYFAQFITTWMNIGSIDSCIAYFPEGENIFKE
FSDTWHNLCKEIVSKKIIMKKLQESXVFDVLLADAIGPCGELVAELLKIPFVYTLRFSPG
FQLEKFGGGLMLPPSYVPVVMSRLSGQMTFMERVKNMICMLYFDFWLETFNEKKWNLLYS
EVLGKPTTLYETVAKAEMWLIRSYWDLEFPHPTLPNFDFVGGLHCKPAKPLTKEMEDFLQ
SSGEHGVVVFSLGSMVSNMTKERANVIASALAQIPQKVLWRFDGKKXNTLGHNTQLYKWL
PQNDLLGHPKTRAFVTHGGANGVYEAIYHGIPMVGIPLFGEQHDNIAHMVAKGVAVKVEF
ITLSSTELLNALVRVLNNPFYKENAMWLSTIHHDQPMNPLDRAVFWIEFVMLHKGAKHLR
PLTQNLTWYQYHSLDVIGSLLACVATITFFVIKCCLFCSQKFVNVRKKQKRE
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccatgaaatggatctcagctctgccgctgctacaaatgagttgttatttcaac
tctggaagttgtggaaaggtgctggtatggccgatggactacagccactggatgaatata
aagaatatactagaggaacttatccagaggagacatgaggtgatagttctgagaccttca
agtttcatttttattgatgctaattcatcatctggaattaaatttgaaacattaactaca
tctatcaatagagatgaatggggaaaatatttcgctcagtttatcactacctggatgaat
attggctcaatcgattcatgtattgcatattttccagaaggagaaaacatttttaaagaa
ttttctgatacttggcataatttatgtaaagaaatagtttcaaaaaagataattatgaaa
aaactccaagaatcttgagtctttgatgtccttcttgcagacgccattggtccctgtggt
gagctggtggctgagctactaaaaataccttttgtgtacactctccggttctctcctggc
ttccaactggaaaaatttgggggaggccttatgcttcctccttcttatgtacctgttgta
atgtcaagactaagtggtcaaatgactttcatggaaagggtaaaaaacatgatatgtatg
ctttattttgacttttggttagaaacgtttaatgagaaaaagtggaatctgctttacagt
gaagttttaggaaaacccactacattatatgagacagtggcaaaggcagaaatgtggctc
attcgaagctactgggatttggaattccctcaccccaccttaccaaattttgattttgtt
gggggactccattgcaaacctgccaaacctctaactaaggagatggaagactttctgcag
agctctggagaacatggtgtcgtggtgttttctctgggatccatggtcagtaacatgacc
aaagaaagggccaatgtgattgcctcagcccttgcacagattccacaaaaggttctttgg
agatttgatggcaagaaancaaataccttaggacacaacactcagttgtacaaatggctc
cctcagaatgatctacttggtcatccaaaaaccagagcttttgtcactcatggtggagcc
aacggtgtttatgaggcaatctaccacggaatcccaatggtgggcattcctttgtttggg
gaacaacatgataacattgctcacatggtggctaaaggagtagctgttaaagtggaattc
ataacattatcaagtacagaattactaaatgcactggtcagagtccttaacaaccctttc
tataaggagaatgctatgtggttgtccaccattcaccatgatcagcccatgaaccccctg
gacagagcagtcttctggattgagtttgtcatgctccacaaaggggccaagcacttgcgg
ccgcttacccaaaacctcacctggtaccagtaccactcactggatgtgattgggtcccta
ctggcttgtgtggcaacaattactttctttgtcataaaatgttgcttgttttgttctcaa
aagtttgtgaatgtgagaaagaagcaaaagagagagtag

KEGG   Heterocephalus glaber (naked mole rat): 101712271Help
Entry
101712271         CDS       T02812                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B17-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00040  Pentose and glucuronate interconversions
hgl00053  Ascorbate and aldarate metabolism
hgl00140  Steroid hormone biosynthesis
hgl00830  Retinol metabolism
hgl00860  Porphyrin and chlorophyll metabolism
hgl00980  Metabolism of xenobiotics by cytochrome P450
hgl00982  Drug metabolism - cytochrome P450
hgl00983  Drug metabolism - other enzymes
hgl01100  Metabolic pathways
hgl05204  Chemical carcinogenesis
Module
hgl_M00014  Glucuronate pathway (uronate pathway)
hgl_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101712271
   00053 Ascorbate and aldarate metabolism
    101712271
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    101712271
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101712271
   00860 Porphyrin and chlorophyll metabolism
    101712271
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101712271
   00982 Drug metabolism - cytochrome P450
    101712271
   00983 Drug metabolism - other enzymes
    101712271
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    101712271
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hgl01003]
    101712271
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101712271
Glycosyltransferases [BR:hgl01003]
 Others
  Hydrophobic molecule
   101712271
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT
Motif
Other DBs
NCBI-GeneID: 101712271
NCBI-ProteinID: XP_004871774
LinkDB All DBs
Position
Un
AA seq 367 aa AA seqDB search
MSVKWISSLLLLQMSCYFNSGSCGKVLVWPMEYSHWMNIKNILEELIHRRHEVTVLRPSS
YIFVDVNSSSGIKFETFTTSANRDQWENFFIHGITRLINIGSKDSCITYFSEVENIFKEF
SETWQNFCKEAVSNKILMNKLQESRFDVLLADAIGLCGELVAELLKIPLVYTLRFSPGYK
IEKNGGGLILPPSYVPVVMSGLGGQMTFMERVKNMICMLYFDFWSDPFNEKKWDEFYSEV
LGKPTTLYEAMGKAEMWLIRSYWDLEFPHPTLPNFDFVGGLHCKPPKPLPKEMEEFVQSS
GEHGVVVLSLGSMVSNMTKERANVIASALAQIPQKVGKVSQWQISTKEVIKSCKYLLSKN
FFLFLQR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgaaatggatctcatctctgctgctactacaaatgagttgttatttcaactct
ggaagttgtggaaaggtgctggtatggccgatggaatacagccactggatgaatataaag
aatatactagaggaacttatccataggagacatgaagtgacagttctgagaccttcaagt
tacatttttgttgatgttaattcatcatctggaattaaatttgaaacatttactacatct
gcgaatagagatcaatgggaaaattttttcattcatggaatcactcggttgattaatatt
ggctccaaagattcatgtattacatatttttcagaagtagaaaacattttcaaagaattt
tctgaaacttggcaaaatttctgtaaagaagcagtctcaaacaagatacttatgaataaa
ctccaagaatcaagatttgatgtccttcttgcagatgccattggtctctgtggtgaactg
gtggctgagctactaaaaatacctttggtgtacactctccggttctctccaggctacaaa
atagaaaaaaatggaggaggccttatacttcctccttcttatgtacctgttgtaatgtca
ggactaggtggtcaaatgactttcatggaaagggtaaaaaacatgatatgtatgctttat
tttgacttttggtctgatccgtttaatgagaaaaagtgggatgagttttacagtgaagtt
ttaggaaaacccactacattatatgaggcaatgggaaaggcagaaatgtggctcattcga
agctattgggatttggaattccctcaccccaccttaccaaattttgattttgttggagga
ctccactgcaaacctcccaaacctctacctaaggaaatggaagaatttgtgcagagctct
ggagaacatggtgtcgtggtgctttctttggggtccatggtcagtaacatgacaaaagaa
agggccaatgtgattgcctcagcccttgcacagattccacaaaaggtgggcaaagtgtct
caatggcaaatatccactaaagaagtcattaaatcctgcaaatatctgctttcaaaaaac
ttctttcttttcctacagcgttag

KEGG   Heterocephalus glaber (naked mole rat): 101713242Help
Entry
101713242         CDS       T02812                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B18
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00040  Pentose and glucuronate interconversions
hgl00053  Ascorbate and aldarate metabolism
hgl00140  Steroid hormone biosynthesis
hgl00830  Retinol metabolism
hgl00860  Porphyrin and chlorophyll metabolism
hgl00980  Metabolism of xenobiotics by cytochrome P450
hgl00982  Drug metabolism - cytochrome P450
hgl00983  Drug metabolism - other enzymes
hgl01100  Metabolic pathways
hgl05204  Chemical carcinogenesis
Module
hgl_M00014  Glucuronate pathway (uronate pathway)
hgl_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101713242
   00053 Ascorbate and aldarate metabolism
    101713242
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    101713242
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101713242
   00860 Porphyrin and chlorophyll metabolism
    101713242
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101713242
   00982 Drug metabolism - cytochrome P450
    101713242
   00983 Drug metabolism - other enzymes
    101713242
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    101713242
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hgl01003]
    101713242
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101713242
Glycosyltransferases [BR:hgl01003]
 Others
  Hydrophobic molecule
   101713242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C Shisa
Motif
Other DBs
NCBI-GeneID: 101713242
NCBI-ProteinID: XP_012923591
LinkDB All DBs
Position
Un
AA seq 238 aa AA seqDB search
MEDFVQSSGEHGVVVFTLGSMVRNITEERANVIASALAQIPQKVIWRFDGKKPDTLGYNT
KLYKWIPQNDLLGHTKTKAFITHGGTNGIYEAIYHGVPMVGIPLFGDQPDNIVRMKAKGA
AVRLDFITMSSTDLLNALKTIINDPYYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHK
GAKHLRVAAHNLSWFQYHSLDVIGFLLTCVVSLVFIIIKCCLFCCRKFTKTGKKKKRE
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggaagactttgtgcagagctctggagaacatggtgttgtggtgtttactctggggtca
atggtcaggaacataacagaagaaagagccaatgtaattgcgtcagcccttgctcagatt
ccacaaaaggtaatatggagatttgatggcaagaaaccagataccctaggatacaacact
aagctgtacaaatggatccctcagaatgaccttcttggtcacaccaaaaccaaagctttt
ataactcatggtggaaccaatggcatatatgaggcaatctaccatggtgtccctatggtg
ggcattcctttgtttggggatcaaccggataacattgttcgcatgaaggccaagggagca
gctgttagattggatttcatcacaatgtcaagtacagatttgctcaatgcattgaagacc
atcattaatgatccttactataaagagaatgccatgaggttatcaagaattcaccatgac
cagccagtgaagcccctggaccgagcagtcttctggattgagtttgtcatgcgccacaaa
ggggccaagcaccttcgagttgcagcccacaacctgtcctggttccagtaccactcttta
gatgtgattgggttcctgctgacctgtgtggtcagtctggtattcatcatcattaaatgt
tgtctattttgttgcagaaagtttacaaaaactggaaaaaagaaaaaaagggagtaa

KEGG   Heterocephalus glaber (naked mole rat): 101713955Help
Entry
101713955         CDS       T02812                                 

Gene name
Ugt2a1
Definition
(RefSeq) UDP-glucuronosyltransferase 2A1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00040  Pentose and glucuronate interconversions
hgl00053  Ascorbate and aldarate metabolism
hgl00140  Steroid hormone biosynthesis
hgl00830  Retinol metabolism
hgl00860  Porphyrin and chlorophyll metabolism
hgl00980  Metabolism of xenobiotics by cytochrome P450
hgl00982  Drug metabolism - cytochrome P450
hgl00983  Drug metabolism - other enzymes
hgl01100  Metabolic pathways
hgl05204  Chemical carcinogenesis
Module
hgl_M00014  Glucuronate pathway (uronate pathway)
hgl_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101713955 (Ugt2a1)
   00053 Ascorbate and aldarate metabolism
    101713955 (Ugt2a1)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    101713955 (Ugt2a1)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101713955 (Ugt2a1)
   00860 Porphyrin and chlorophyll metabolism
    101713955 (Ugt2a1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101713955 (Ugt2a1)
   00982 Drug metabolism - cytochrome P450
    101713955 (Ugt2a1)
   00983 Drug metabolism - other enzymes
    101713955 (Ugt2a1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    101713955 (Ugt2a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hgl01003]
    101713955 (Ugt2a1)
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101713955 (Ugt2a1)
Glycosyltransferases [BR:hgl01003]
 Others
  Hydrophobic molecule
   101713955 (Ugt2a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C
Motif
Other DBs
NCBI-GeneID: 101713955
NCBI-ProteinID: XP_004871778
LinkDB All DBs
Position
Un
AA seq 527 aa AA seqDB search
MLSNILLLSLQISLLGTTLGGNILIWPMEGSHWLNVKIIIDELIKKEHNVTVLVASGALF
ITPSSYPSLTFEIYKVSFGKERVERVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHM
VSREICDGVLKNEMLMEKLKKGKFEVLVSDPVFPCGDIVALKLGIPFIYSLRFSPASNVE
KHCGKVPYPPSYVPAILSELTDQMTFADRVRNFISYHLQDYMFETLWKPWDSYYSKALGK
PTTLCETMSKAEIWLIRTYWDFEFPRPFLPNFEFVGGLHCKPAKPLPKEMEEFVQSSGED
GIVVFSLGSMVKNLTEEKANLIASALSQIPQKVLWRYKGKKPAMLGPNTQLFDWIPQNDL
LGHPKTKAFITHGGTNGIYEAIYHGIPMVGVPMFADQPDNIAHMKAKGAAVEVNMNTMTS
ADLLNALRIVINDPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHD
LSWFQYHSLDVIGFLLGCVASVVFLVTKCCLFSYQKFIRKGKRIKKE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttaagcaacattctgctgttgtctcttcagataagcctcctaggaaccactcttggt
gggaacatcctgatttggccaatggaaggtagtcactggctcaatgttaagatcattata
gatgagctcattaaaaaagagcataatgtgactgtcctggttgcctctggtgcacttttc
atcacaccatcttcttacccgtctctgacatttgaaatatataaagtgtcctttggaaaa
gaaagagtagaaagagtgatcaaggattttgttttgacatggctggaaaataggccatct
ccttcaaccatctggagattctatcaggagatggctaaagtcataaaggacttccacatg
gtgtctagagagatctgtgatggtgttcttaaaaatgaaatgctgatggaaaagctgaag
aaaggcaagtttgaagtcctggtatcagatccagtattcccttgtggtgatatagtagct
ttaaagctgggaataccattcatctattccttgaggttttctccagcctcaaatgtggaa
aagcactgtgggaaagtaccataccctccttcctatgttcctgctattttatcagaactt
actgaccagatgacatttgcggacagagtaagaaatttcatctcctaccacctacaggac
tacatgtttgaaactctttggaaaccatgggattcctactatagtaaagcattgggaaaa
cccactacgttatgtgagactatgagcaaagctgaaatttggctaattcggacatattgg
gattttgaatttcctcgtccattcttgcctaattttgagtttgttggaggactgcactgc
aaacctgccaaacctttacctaaagaaatggaagaatttgtccagagttctggtgaagat
ggtattgtggtgttttctctggggtcaatggtgaaaaacctcacagaagaaaaggccaat
ctcatcgcctcggccctctctcagattccacagaaggttttgtggagatacaagggaaag
aagccagccatgttaggaccgaatactcagctgtttgattggattccccagaatgacctt
ctcggtcatcccaaaactaaagctttcatcactcatggtggaactaatgggatctatgaa
gctatttatcatgggatccctatggtgggggttcccatgtttgcagatcaacctgacaac
attgctcacatgaaggccaaaggagcagctgtggaggtcaacatgaacacaatgacgagt
gcagacctgctcaatgccttgagaatagtcatcaatgacccttcttataaagagaatgcc
atgaggttatcaagaattcaccatgaccagccagtgaagcccctggaccgagcagtcttc
tggattgagtttgtcatgcgccacaaaggggccaagcaccttcgggttgcagcccacgac
ctgtcctggttccaatatcactctttggatgtgattgggttcctgttgggctgtgtagca
agtgttgtattcttggtcacaaagtgttgtttgttttcctatcaaaaatttattaggaaa
ggaaagaggataaagaaggaatag

KEGG   Heterocephalus glaber (naked mole rat): 101726630Help
Entry
101726630         CDS       T02812                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 1-2-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00040  Pentose and glucuronate interconversions
hgl00053  Ascorbate and aldarate metabolism
hgl00140  Steroid hormone biosynthesis
hgl00830  Retinol metabolism
hgl00860  Porphyrin and chlorophyll metabolism
hgl00980  Metabolism of xenobiotics by cytochrome P450
hgl00982  Drug metabolism - cytochrome P450
hgl00983  Drug metabolism - other enzymes
hgl01100  Metabolic pathways
hgl05204  Chemical carcinogenesis
Module
hgl_M00014  Glucuronate pathway (uronate pathway)
hgl_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101726630
   00053 Ascorbate and aldarate metabolism
    101726630
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    101726630
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101726630
   00860 Porphyrin and chlorophyll metabolism
    101726630
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101726630
   00982 Drug metabolism - cytochrome P450
    101726630
   00983 Drug metabolism - other enzymes
    101726630
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    101726630
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hgl01003]
    101726630
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101726630
Glycosyltransferases [BR:hgl01003]
 Others
  Hydrophobic molecule
   101726630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 101726630
NCBI-ProteinID: XP_004868574
LinkDB All DBs
Position
Un
AA seq 226 aa AA seqDB search
GSMISDIPEKKAMAIAEGLGKVPQTVLWRYTGTPPSNLAKNTILVKWLPQNDLLGHPKTR
AFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTSDDLANAL
KKVIYDKSYKENILRLSTLHKDRPIEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYH
SLDVIGFLLAITLSVSFITLKCCAYGFRKCFGKKEHVKKTPKSKTH
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
ggatccatgatttcagacattccggaaaagaaagctatggccattgctgagggtttgggc
aaagttcctcaaacggtcctgtggcgctacactggaactccaccatcaaatcttgcaaag
aatacgatccttgtgaagtggttaccccagaatgatctgcttggtcacccaaagacccgg
gcgtttatcacacattctggctcccatggtatctatgaaggaatatgcaatggtgtcccc
atggtcatgatgcccttgtttggagatcagatggacaatgcaaagcgcatggagacacgg
ggagctggtgtgaccttgaatgtccttgaaatgacttctgatgatttagcaaatgctcta
aaaaaggtcatctatgacaaaagctacaaggagaacatcctgcgcctctccaccctgcac
aaggaccgacccatagagccactggacctggctgtgttctgggtggaattcgtgatgagg
cacaagggggcgccacacctgcgccctgcagcccacgacctcacctggtaccagtaccac
tccttggacgtgatcggcttcctcctggccattacgctgtctgtgtccttcatcaccctc
aagtgttgcgcctatggcttccggaaatgctttgggaaaaaggagcatgtgaagaaaacc
ccaaaatccaagacacattga

DBGET integrated database retrieval system