KEGG   Heterocephalus glaber (naked mole rat): 101698286
Entry
101698286         CDS       T02812                                 

Gene name
Mapk9
Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01522  Endocrine resistance
hgl04010  MAPK signaling pathway
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04024  cAMP signaling pathway
hgl04068  FoxO signaling pathway
hgl04071  Sphingolipid signaling pathway
hgl04137  Mitophagy - animal
hgl04140  Autophagy - animal
hgl04141  Protein processing in endoplasmic reticulum
hgl04210  Apoptosis
hgl04215  Apoptosis - multiple species
hgl04217  Necroptosis
hgl04310  Wnt signaling pathway
hgl04380  Osteoclast differentiation
hgl04510  Focal adhesion
hgl04530  Tight junction
hgl04620  Toll-like receptor signaling pathway
hgl04621  NOD-like receptor signaling pathway
hgl04622  RIG-I-like receptor signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04657  IL-17 signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl04660  T cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04668  TNF signaling pathway
hgl04722  Neurotrophin signaling pathway
hgl04723  Retrograde endocannabinoid signaling
hgl04728  Dopaminergic synapse
hgl04750  Inflammatory mediator regulation of TRP channels
hgl04910  Insulin signaling pathway
hgl04912  GnRH signaling pathway
hgl04914  Progesterone-mediated oocyte maturation
hgl04917  Prolactin signaling pathway
hgl04920  Adipocytokine signaling pathway
hgl04926  Relaxin signaling pathway
hgl04930  Type II diabetes mellitus
hgl04931  Insulin resistance
hgl04932  Non-alcoholic fatty liver disease
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04935  Growth hormone synthesis, secretion and action
hgl05010  Alzheimer disease
hgl05012  Parkinson disease
hgl05016  Huntington disease
hgl05017  Spinocerebellar ataxia
hgl05020  Prion disease
hgl05022  Pathways of neurodegeneration - multiple diseases
hgl05132  Salmonella infection
hgl05133  Pertussis
hgl05135  Yersinia infection
hgl05142  Chagas disease
hgl05145  Toxoplasmosis
hgl05152  Tuberculosis
hgl05161  Hepatitis B
hgl05162  Measles
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05231  Choline metabolism in cancer
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101698286 (Mapk9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101698286 (Mapk9)
   04012 ErbB signaling pathway
    101698286 (Mapk9)
   04014 Ras signaling pathway
    101698286 (Mapk9)
   04310 Wnt signaling pathway
    101698286 (Mapk9)
   04668 TNF signaling pathway
    101698286 (Mapk9)
   04068 FoxO signaling pathway
    101698286 (Mapk9)
   04071 Sphingolipid signaling pathway
    101698286 (Mapk9)
   04024 cAMP signaling pathway
    101698286 (Mapk9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101698286 (Mapk9)
   04137 Mitophagy - animal
    101698286 (Mapk9)
  09143 Cell growth and death
   04210 Apoptosis
    101698286 (Mapk9)
   04215 Apoptosis - multiple species
    101698286 (Mapk9)
   04217 Necroptosis
    101698286 (Mapk9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101698286 (Mapk9)
   04530 Tight junction
    101698286 (Mapk9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101698286 (Mapk9)
   04621 NOD-like receptor signaling pathway
    101698286 (Mapk9)
   04622 RIG-I-like receptor signaling pathway
    101698286 (Mapk9)
   04625 C-type lectin receptor signaling pathway
    101698286 (Mapk9)
   04660 T cell receptor signaling pathway
    101698286 (Mapk9)
   04658 Th1 and Th2 cell differentiation
    101698286 (Mapk9)
   04659 Th17 cell differentiation
    101698286 (Mapk9)
   04657 IL-17 signaling pathway
    101698286 (Mapk9)
   04664 Fc epsilon RI signaling pathway
    101698286 (Mapk9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101698286 (Mapk9)
   04920 Adipocytokine signaling pathway
    101698286 (Mapk9)
   04912 GnRH signaling pathway
    101698286 (Mapk9)
   04914 Progesterone-mediated oocyte maturation
    101698286 (Mapk9)
   04917 Prolactin signaling pathway
    101698286 (Mapk9)
   04926 Relaxin signaling pathway
    101698286 (Mapk9)
   04935 Growth hormone synthesis, secretion and action
    101698286 (Mapk9)
  09156 Nervous system
   04728 Dopaminergic synapse
    101698286 (Mapk9)
   04723 Retrograde endocannabinoid signaling
    101698286 (Mapk9)
   04722 Neurotrophin signaling pathway
    101698286 (Mapk9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101698286 (Mapk9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101698286 (Mapk9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101698286 (Mapk9)
   05231 Choline metabolism in cancer
    101698286 (Mapk9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101698286 (Mapk9)
   05212 Pancreatic cancer
    101698286 (Mapk9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101698286 (Mapk9)
   05012 Parkinson disease
    101698286 (Mapk9)
   05016 Huntington disease
    101698286 (Mapk9)
   05017 Spinocerebellar ataxia
    101698286 (Mapk9)
   05020 Prion disease
    101698286 (Mapk9)
   05022 Pathways of neurodegeneration - multiple diseases
    101698286 (Mapk9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101698286 (Mapk9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101698286 (Mapk9)
   04932 Non-alcoholic fatty liver disease
    101698286 (Mapk9)
   04931 Insulin resistance
    101698286 (Mapk9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101698286 (Mapk9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101698286 (Mapk9)
   05135 Yersinia infection
    101698286 (Mapk9)
   05133 Pertussis
    101698286 (Mapk9)
   05152 Tuberculosis
    101698286 (Mapk9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101698286 (Mapk9)
   05170 Human immunodeficiency virus 1 infection
    101698286 (Mapk9)
   05161 Hepatitis B
    101698286 (Mapk9)
   05171 Coronavirus disease - COVID-19
    101698286 (Mapk9)
   05162 Measles
    101698286 (Mapk9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101698286 (Mapk9)
   05169 Epstein-Barr virus infection
    101698286 (Mapk9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101698286 (Mapk9)
   05142 Chagas disease
    101698286 (Mapk9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101698286 (Mapk9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101698286 (Mapk9)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101698286 (Mapk9)
Protein kinases [BR:hgl01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101698286 (Mapk9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 101698286
NCBI-ProteinID: XP_004836798
UniProt: G5C7A6
LinkDB
Position
Un
AA seq 424 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESDRDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtgacagcaaatgtgatagtcagttttacagtgtgcaagtggcagactcaactttc
actgtcctgaaacggtaccagcagttgaaaccaattggctctggagcccaagggattgtt
tgtgctgcttttgatacagttcttgggattaatgttgcagtcaagaaactaagccgtcct
tttcaaaatcaaactcacgcaaagagagcttatcgtgaacttgtcctcttaaaatgtgtc
aatcataaaaatatcattagtttgttaaatgtgttcacaccacaaaaaactctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcat
atggaattggaccatgaaagaatgtcctaccttctttaccagatgctttgtggtattaaa
catctgcattcagctggtataattcatagagatttgaagcctagcaacattgtagtaaaa
tcagattgtacccttaagatccttgactttggtctggcccggacggcatgtaccaacttt
atgatgaccccctatgtggtaactcggtattaccgggcgcccgaagtcatcctgggcatg
ggctacaaagagaacgttgatatctggtcagtgggttgcatcatgggcgagctggtgaaa
ggttgtgtgatattccaaggcactgaccatattgatcagtggaataaagttattgagcaa
ctgggaacaccatcagcagagttcatgaagaaacttcagccaactgtgagaaattatgta
gaaaatcgaccaaagtatcctggaatcaaatttgaagaactctttccagattggatattc
ccatcagaatccgatcgagacaaaataaaaacgagtcaagccagagatctgttatcaaaa
atgttagtgatcgatcccgacaagcggatctctgtggacgaagccttgcgtcacccctac
attactgtgtggtatgaccctgctgaagcagaagcgccaccacctcagatttacgatgcc
cagttggaagaaagagaacatgcaattgaagagtggaaagaactaatttacaaagaagta
atggactgggaagaaagaagcaagaatggcgttgtaaaagatcaaccttcagatgcagca
gtaagtagcaacgccactccttctcagtcgtcctctatcaatgacatttcatccatgtcc
actgagcagacactggcctcagacacagacagcagtcttgatgcctccacaggacccctc
gaaggttgtcgatga

KEGG   Heterocephalus glaber (naked mole rat): 101712980
Entry
101712980         CDS       T02812                                 

Gene name
Mapk10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01522  Endocrine resistance
hgl04010  MAPK signaling pathway
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04024  cAMP signaling pathway
hgl04068  FoxO signaling pathway
hgl04071  Sphingolipid signaling pathway
hgl04137  Mitophagy - animal
hgl04140  Autophagy - animal
hgl04141  Protein processing in endoplasmic reticulum
hgl04210  Apoptosis
hgl04215  Apoptosis - multiple species
hgl04217  Necroptosis
hgl04310  Wnt signaling pathway
hgl04380  Osteoclast differentiation
hgl04510  Focal adhesion
hgl04530  Tight junction
hgl04620  Toll-like receptor signaling pathway
hgl04621  NOD-like receptor signaling pathway
hgl04622  RIG-I-like receptor signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04657  IL-17 signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl04660  T cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04668  TNF signaling pathway
hgl04722  Neurotrophin signaling pathway
hgl04723  Retrograde endocannabinoid signaling
hgl04728  Dopaminergic synapse
hgl04750  Inflammatory mediator regulation of TRP channels
hgl04910  Insulin signaling pathway
hgl04912  GnRH signaling pathway
hgl04914  Progesterone-mediated oocyte maturation
hgl04917  Prolactin signaling pathway
hgl04920  Adipocytokine signaling pathway
hgl04926  Relaxin signaling pathway
hgl04930  Type II diabetes mellitus
hgl04931  Insulin resistance
hgl04932  Non-alcoholic fatty liver disease
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04935  Growth hormone synthesis, secretion and action
hgl05010  Alzheimer disease
hgl05012  Parkinson disease
hgl05016  Huntington disease
hgl05017  Spinocerebellar ataxia
hgl05020  Prion disease
hgl05022  Pathways of neurodegeneration - multiple diseases
hgl05132  Salmonella infection
hgl05133  Pertussis
hgl05135  Yersinia infection
hgl05142  Chagas disease
hgl05145  Toxoplasmosis
hgl05152  Tuberculosis
hgl05161  Hepatitis B
hgl05162  Measles
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05231  Choline metabolism in cancer
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101712980 (Mapk10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101712980 (Mapk10)
   04012 ErbB signaling pathway
    101712980 (Mapk10)
   04014 Ras signaling pathway
    101712980 (Mapk10)
   04310 Wnt signaling pathway
    101712980 (Mapk10)
   04668 TNF signaling pathway
    101712980 (Mapk10)
   04068 FoxO signaling pathway
    101712980 (Mapk10)
   04071 Sphingolipid signaling pathway
    101712980 (Mapk10)
   04024 cAMP signaling pathway
    101712980 (Mapk10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101712980 (Mapk10)
   04137 Mitophagy - animal
    101712980 (Mapk10)
  09143 Cell growth and death
   04210 Apoptosis
    101712980 (Mapk10)
   04215 Apoptosis - multiple species
    101712980 (Mapk10)
   04217 Necroptosis
    101712980 (Mapk10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101712980 (Mapk10)
   04530 Tight junction
    101712980 (Mapk10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101712980 (Mapk10)
   04621 NOD-like receptor signaling pathway
    101712980 (Mapk10)
   04622 RIG-I-like receptor signaling pathway
    101712980 (Mapk10)
   04625 C-type lectin receptor signaling pathway
    101712980 (Mapk10)
   04660 T cell receptor signaling pathway
    101712980 (Mapk10)
   04658 Th1 and Th2 cell differentiation
    101712980 (Mapk10)
   04659 Th17 cell differentiation
    101712980 (Mapk10)
   04657 IL-17 signaling pathway
    101712980 (Mapk10)
   04664 Fc epsilon RI signaling pathway
    101712980 (Mapk10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101712980 (Mapk10)
   04920 Adipocytokine signaling pathway
    101712980 (Mapk10)
   04912 GnRH signaling pathway
    101712980 (Mapk10)
   04914 Progesterone-mediated oocyte maturation
    101712980 (Mapk10)
   04917 Prolactin signaling pathway
    101712980 (Mapk10)
   04926 Relaxin signaling pathway
    101712980 (Mapk10)
   04935 Growth hormone synthesis, secretion and action
    101712980 (Mapk10)
  09156 Nervous system
   04728 Dopaminergic synapse
    101712980 (Mapk10)
   04723 Retrograde endocannabinoid signaling
    101712980 (Mapk10)
   04722 Neurotrophin signaling pathway
    101712980 (Mapk10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101712980 (Mapk10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101712980 (Mapk10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101712980 (Mapk10)
   05231 Choline metabolism in cancer
    101712980 (Mapk10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101712980 (Mapk10)
   05212 Pancreatic cancer
    101712980 (Mapk10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101712980 (Mapk10)
   05012 Parkinson disease
    101712980 (Mapk10)
   05016 Huntington disease
    101712980 (Mapk10)
   05017 Spinocerebellar ataxia
    101712980 (Mapk10)
   05020 Prion disease
    101712980 (Mapk10)
   05022 Pathways of neurodegeneration - multiple diseases
    101712980 (Mapk10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101712980 (Mapk10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101712980 (Mapk10)
   04932 Non-alcoholic fatty liver disease
    101712980 (Mapk10)
   04931 Insulin resistance
    101712980 (Mapk10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101712980 (Mapk10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101712980 (Mapk10)
   05135 Yersinia infection
    101712980 (Mapk10)
   05133 Pertussis
    101712980 (Mapk10)
   05152 Tuberculosis
    101712980 (Mapk10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101712980 (Mapk10)
   05170 Human immunodeficiency virus 1 infection
    101712980 (Mapk10)
   05161 Hepatitis B
    101712980 (Mapk10)
   05171 Coronavirus disease - COVID-19
    101712980 (Mapk10)
   05162 Measles
    101712980 (Mapk10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101712980 (Mapk10)
   05169 Epstein-Barr virus infection
    101712980 (Mapk10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101712980 (Mapk10)
   05142 Chagas disease
    101712980 (Mapk10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101712980 (Mapk10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101712980 (Mapk10)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101712980 (Mapk10)
Protein kinases [BR:hgl01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101712980 (Mapk10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 101712980
NCBI-ProteinID: XP_004870572
UniProt: G5C950
LinkDB
Position
Un
AA seq 464 aa
MSLHFLYYCSEPTLDVKVAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagcctccatttcttatactactgcagtgaaccaaccttggatgtgaaagttgccttt
tgtcagggattcgataaacaagtggatgtgtcatatatagccaaacattacaacatgagc
aaaagcaaagtggacaaccagttctacagtgtggaagtgggagactcgaccttcacagtt
ctcaagcgctaccagaatctaaagcctattggctctggggctcaggggatagtgtgtgct
gcatatgatgctgtcctggacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacgcatgccaagagagcctaccgggagctggtcctcatgaagtgtgtgaaccat
aaaaatattattagcttattaaatgtcttcacacctcagaaaacgctggaggagttccag
gatgtttacttagtaatggaattgatggacgccaacctgtgtcaggtgattcagatggaa
ttagaccatgagcggatgtcgtacctgctataccagatgttgtgtggcatcaaacatctg
cactctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaagtccgat
tgcacgttgaaaatcctggactttggactggccaggacagcaggcacaagcttcatgatg
acgccgtacgtggtgacacgttattacagagccccggaggtcatcctgggaatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggactatattgaccagtggaataaagtcattgagcaactagga
acaccatgtccagaattcatgaagaaattgcagcccacagtaagaaactatgtggagaat
cggccaaagtatgctggactcacctttcccaagctctttccagactccctcttcccagcg
gactctgagcacaataaacttaaagccagccaagcccgggatttgttgtcaaagatgcta
gtgattgacccagccaaaaggatatctgtggacgacgccttacagcacccctacatcaac
gtttggtacgaccctgcagaggtggaggcgcctccacctcagatttatgacaaacagctg
gatgaaagagaacacaccattgaagaatggaaagaacttatttacaaggaagtaatgaat
tcagaagaaaagactaaaaatggtgtagtaaaaggacagccttctccttcaggtgcagca
gtgaacagcagtgagagtctccctccatcttcgtccgtcaatgacatctcctccatgtcc
accgaccagaccctggcatctgacactgacagcagcttggaagcctcagcgggacccctg
ggttgttgcaggtga

KEGG   Heterocephalus glaber (naked mole rat): 101715259
Entry
101715259         CDS       T02812                                 

Gene name
Mapk8
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01522  Endocrine resistance
hgl04010  MAPK signaling pathway
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04024  cAMP signaling pathway
hgl04068  FoxO signaling pathway
hgl04071  Sphingolipid signaling pathway
hgl04137  Mitophagy - animal
hgl04140  Autophagy - animal
hgl04141  Protein processing in endoplasmic reticulum
hgl04210  Apoptosis
hgl04215  Apoptosis - multiple species
hgl04217  Necroptosis
hgl04310  Wnt signaling pathway
hgl04380  Osteoclast differentiation
hgl04510  Focal adhesion
hgl04530  Tight junction
hgl04620  Toll-like receptor signaling pathway
hgl04621  NOD-like receptor signaling pathway
hgl04622  RIG-I-like receptor signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04657  IL-17 signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl04660  T cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04668  TNF signaling pathway
hgl04722  Neurotrophin signaling pathway
hgl04723  Retrograde endocannabinoid signaling
hgl04728  Dopaminergic synapse
hgl04750  Inflammatory mediator regulation of TRP channels
hgl04910  Insulin signaling pathway
hgl04912  GnRH signaling pathway
hgl04914  Progesterone-mediated oocyte maturation
hgl04917  Prolactin signaling pathway
hgl04920  Adipocytokine signaling pathway
hgl04926  Relaxin signaling pathway
hgl04930  Type II diabetes mellitus
hgl04931  Insulin resistance
hgl04932  Non-alcoholic fatty liver disease
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04935  Growth hormone synthesis, secretion and action
hgl05010  Alzheimer disease
hgl05012  Parkinson disease
hgl05016  Huntington disease
hgl05017  Spinocerebellar ataxia
hgl05020  Prion disease
hgl05022  Pathways of neurodegeneration - multiple diseases
hgl05132  Salmonella infection
hgl05133  Pertussis
hgl05135  Yersinia infection
hgl05142  Chagas disease
hgl05145  Toxoplasmosis
hgl05152  Tuberculosis
hgl05161  Hepatitis B
hgl05162  Measles
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05231  Choline metabolism in cancer
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101715259 (Mapk8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101715259 (Mapk8)
   04012 ErbB signaling pathway
    101715259 (Mapk8)
   04014 Ras signaling pathway
    101715259 (Mapk8)
   04310 Wnt signaling pathway
    101715259 (Mapk8)
   04668 TNF signaling pathway
    101715259 (Mapk8)
   04068 FoxO signaling pathway
    101715259 (Mapk8)
   04071 Sphingolipid signaling pathway
    101715259 (Mapk8)
   04024 cAMP signaling pathway
    101715259 (Mapk8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101715259 (Mapk8)
   04137 Mitophagy - animal
    101715259 (Mapk8)
  09143 Cell growth and death
   04210 Apoptosis
    101715259 (Mapk8)
   04215 Apoptosis - multiple species
    101715259 (Mapk8)
   04217 Necroptosis
    101715259 (Mapk8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101715259 (Mapk8)
   04530 Tight junction
    101715259 (Mapk8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101715259 (Mapk8)
   04621 NOD-like receptor signaling pathway
    101715259 (Mapk8)
   04622 RIG-I-like receptor signaling pathway
    101715259 (Mapk8)
   04625 C-type lectin receptor signaling pathway
    101715259 (Mapk8)
   04660 T cell receptor signaling pathway
    101715259 (Mapk8)
   04658 Th1 and Th2 cell differentiation
    101715259 (Mapk8)
   04659 Th17 cell differentiation
    101715259 (Mapk8)
   04657 IL-17 signaling pathway
    101715259 (Mapk8)
   04664 Fc epsilon RI signaling pathway
    101715259 (Mapk8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101715259 (Mapk8)
   04920 Adipocytokine signaling pathway
    101715259 (Mapk8)
   04912 GnRH signaling pathway
    101715259 (Mapk8)
   04914 Progesterone-mediated oocyte maturation
    101715259 (Mapk8)
   04917 Prolactin signaling pathway
    101715259 (Mapk8)
   04926 Relaxin signaling pathway
    101715259 (Mapk8)
   04935 Growth hormone synthesis, secretion and action
    101715259 (Mapk8)
  09156 Nervous system
   04728 Dopaminergic synapse
    101715259 (Mapk8)
   04723 Retrograde endocannabinoid signaling
    101715259 (Mapk8)
   04722 Neurotrophin signaling pathway
    101715259 (Mapk8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101715259 (Mapk8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101715259 (Mapk8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101715259 (Mapk8)
   05231 Choline metabolism in cancer
    101715259 (Mapk8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101715259 (Mapk8)
   05212 Pancreatic cancer
    101715259 (Mapk8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101715259 (Mapk8)
   05012 Parkinson disease
    101715259 (Mapk8)
   05016 Huntington disease
    101715259 (Mapk8)
   05017 Spinocerebellar ataxia
    101715259 (Mapk8)
   05020 Prion disease
    101715259 (Mapk8)
   05022 Pathways of neurodegeneration - multiple diseases
    101715259 (Mapk8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101715259 (Mapk8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101715259 (Mapk8)
   04932 Non-alcoholic fatty liver disease
    101715259 (Mapk8)
   04931 Insulin resistance
    101715259 (Mapk8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101715259 (Mapk8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101715259 (Mapk8)
   05135 Yersinia infection
    101715259 (Mapk8)
   05133 Pertussis
    101715259 (Mapk8)
   05152 Tuberculosis
    101715259 (Mapk8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101715259 (Mapk8)
   05170 Human immunodeficiency virus 1 infection
    101715259 (Mapk8)
   05161 Hepatitis B
    101715259 (Mapk8)
   05171 Coronavirus disease - COVID-19
    101715259 (Mapk8)
   05162 Measles
    101715259 (Mapk8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101715259 (Mapk8)
   05169 Epstein-Barr virus infection
    101715259 (Mapk8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101715259 (Mapk8)
   05142 Chagas disease
    101715259 (Mapk8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101715259 (Mapk8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101715259 (Mapk8)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101715259 (Mapk8)
Protein kinases [BR:hgl01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101715259 (Mapk8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 101715259
NCBI-ProteinID: XP_004874593
UniProt: G5B0W2
LinkDB
Position
Un
AA seq 427 aa
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacaacaatttttatagcgtagagattggagattctacattc
acagtcctgaaacgataccagaatttaaaacctataggttcaggagctcaaggaatagta
tgtgcagcttatgatgctattctggaaagaaatgttgcaatcaagaagctaagccggcca
tttcagaatcaaactcatgccaagcgggcctacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagcttatggatgccaatctctgccaagtgattcag
atggaactagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaaacccagtaacatagtagtaaaa
tcagactgcactttgaagattcttgactttggactggctaggactgcaggaacaagtttc
atgatgacaccttacgtagtgactcgctactaccgagcacctgaggtcatcttaggcatg
ggatacaaggaaaacgtggatttatggtctgtggggtgcattatgggcgaaatggtttgc
cacaaaatcctctttccaggaagggactatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaaactacaaccaacagtaaggacttatgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccctgatgtacttttc
ccagctgactcagaacacaacaaacttaaagccagtcaggcacgggatttgttatccaaa
atgctggtaatagatgcatctaaaaggatctccgtggatgaagcactccagcacccatac
atcaatgtctggtatgatccctccgaagcggaagctccaccaccaaagatccccgacaaa
cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatacaaggaagtg
atggacttagaggagagaaccaagaatggagttatccgggggcagccttctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcatcatctgtcaatgatgtgtct
tcaatgtccacagatccgactttggcctcggataccgacagcagtctagaagcatcagct
ggacctctgggctgctgtagatga

DBGET integrated database retrieval system