KEGG   Heterocephalus glaber (naked mole rat): 101698341Help
Entry
101698341         CDS       T02812                                 

Gene name
Ribc2
Definition
(RefSeq) RIB43A domain with coiled-coils 2
Organism
hgl  Heterocephalus glaber (naked mole rat)
SSDB OrthologParalogGFIT
Motif
Pfam: RIB43A C8
Motif
Other DBs
NCBI-GeneID: 101698341
NCBI-ProteinID: XP_004845457
LinkDB All DBs
Position
Un
AA seq 377 aa AA seqDB search
MKAVLAKDLEQDAKLAKRTHAELCKQQRVFNARNRIIGGDTQAWDIQVHDQRIKEATEKA
RHETFAAELRQNDKVICILDDREKRDRKCLCRAISDFQQNCQKPETRREFDLSDPLALKK
ELPARQSDSDVRNTVSGMQKFMGEDLNFQERKKFQEEQMREWSLQQHREWERARADQKFA
EDHYTQTRLNFDETASHLQKLESITRKAVCAAVKEFNRKQAMESAERKRQEKRQEQEDNM
AEISSQLRGDLLSENPQQAASSFGPHRVVPDRWKGMSREQLEGVRLAQKQQIQEKLRLQE
EARQRDLDWDRRRVQKARVALLGERRQHRQQCEDRRALDRSNLRLAAEQRLQKKYMDEIC
ANQPTADYFAQFNTRSR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtgctggccaaggacctggagcaggacgccaagctggccaagaggacacat
gcggagctgtgcaagcagcagcgggtcttcaacgccaggaaccggatcattgggggagac
acacaagcctgggatattcaggttcatgaccagaggataaaagaagcaactgaaaaagct
aggcatgaaacctttgctgccgaattgaggcaaaatgacaaggtcatctgcatattagac
gaccgggagaagagagatagaaaatgtctctgcagagctatcagtgacttccaacagaac
tgtcagaagccagaaactcgccgtgagtttgatctgtctgaccctctagcccttaagaaa
gagcttccagcccggcagtcagacagtgacgtccggaacacagtatcagggatgcagaag
tttatgggcgaggacctaaacttccaggagaggaagaaattccaagaagaacagatgaga
gaatggtccttacaacagcacagggaatgggagagggcccgtgctgaccagaaatttgca
gaggaccactacacacagaccaggctgaactttgatgagacagccagtcacctgcagaag
ctggaaagcatcaccaggaaggctgtctgtgcagctgtgaaggagttcaacaggaagcag
gccatggagtcagcggaaaggaaaagacaagagaaaagacaagaacaggaggacaacatg
gctgagatctccagccagctgcggggagacctgctctcagagaaccctcagcaggcagcc
agctcctttgggcctcaccgtgtggtgccagaccgctggaaggggatgagccgggagcag
ctagagggcgtccgtctggcccagaagcagcagatccaggagaagctgcggctccaggag
gaagcgcgccagcgggacctggactgggaccggcggcgggtacagaaggcccgtgttgcg
ctgctgggtgagcggcggcagcatcgccagcagtgcgaggaccggagggctctggaccga
agcaacctccgtctggccgcggagcagcgtctgcaaaagaaatatatggatgaaatctgt
gcaaatcaacccacggccgattattttgctcaatttaatacaagaagtcgataa

DBGET integrated database retrieval system