KEGG   Heterocephalus glaber (naked mole rat): 101698721
Entry
101698721         CDS       T02812                                 

Gene name
Cdkn1b
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01522  Endocrine resistance
hgl04012  ErbB signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04068  FoxO signaling pathway
hgl04110  Cell cycle
hgl04151  PI3K-Akt signaling pathway
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04934  Cushing syndrome
hgl05162  Measles
hgl05165  Human papillomavirus infection
hgl05169  Epstein-Barr virus infection
hgl05200  Pathways in cancer
hgl05202  Transcriptional misregulation in cancer
hgl05203  Viral carcinogenesis
hgl05206  MicroRNAs in cancer
hgl05215  Prostate cancer
hgl05220  Chronic myeloid leukemia
hgl05222  Small cell lung cancer
hgl05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101698721 (Cdkn1b)
   04066 HIF-1 signaling pathway
    101698721 (Cdkn1b)
   04068 FoxO signaling pathway
    101698721 (Cdkn1b)
   04151 PI3K-Akt signaling pathway
    101698721 (Cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101698721 (Cdkn1b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101698721 (Cdkn1b)
   05202 Transcriptional misregulation in cancer
    101698721 (Cdkn1b)
   05206 MicroRNAs in cancer
    101698721 (Cdkn1b)
   05203 Viral carcinogenesis
    101698721 (Cdkn1b)
  09162 Cancer: specific types
   05226 Gastric cancer
    101698721 (Cdkn1b)
   05220 Chronic myeloid leukemia
    101698721 (Cdkn1b)
   05215 Prostate cancer
    101698721 (Cdkn1b)
   05222 Small cell lung cancer
    101698721 (Cdkn1b)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101698721 (Cdkn1b)
   04934 Cushing syndrome
    101698721 (Cdkn1b)
  09172 Infectious disease: viral
   05162 Measles
    101698721 (Cdkn1b)
   05169 Epstein-Barr virus infection
    101698721 (Cdkn1b)
   05165 Human papillomavirus infection
    101698721 (Cdkn1b)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101698721 (Cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101698721
NCBI-ProteinID: XP_004845916
UniProt: A0A0P6JT45
LinkDB
Position
Un
AA seq 198 aa
MSNVRVSNGSPSLERTDARQAEHPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGAGKVPPQESRDVSGSRPAAPLTG
SQANSEDTHLVDPKSDPSDSQTGLAEQCAGIRKRPATDDSSPQNKRANRTEENVSDASPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtcgaacgggagccccagcctggagcgcacggacgcccggcag
gcggagcaccccaagccctctgcctgcagaaacctcttcgggcccgtgaatcacgaagag
ttaacccgggacttggagaagcactgcagggacatggaggaggcgagccagcgcaagtgg
aatttcgattttcagaatcacaagcccctggagggcaagtacgagtggcaggaggtggag
aagggcagcctgcccgagttctactacagacccccgcggccccccaagggcgcaggcaag
gtgccgccgcaggagagccgggatgttagcgggagccgcccggcggcgcctttaacaggg
tctcaggcaaactcagaggacacgcacttggtagatccaaagtctgacccgtcggacagc
cagacggggttagcggagcagtgcgcaggcatcaggaagcgacctgccaccgacgattct
tcccctcaaaacaaaagagccaacagaacagaagaaaatgtttcagacgcttcccccaac
gcaggttctgtggagcagacgcccaagaagcctggcctccgaagacgtcaaacgtaa

DBGET integrated database retrieval system