KEGG   Heterocephalus glaber (naked mole rat): 101698830
Entry
101698830         CDS       T02812                                 

Gene name
Pdgfb
Definition
(RefSeq) platelet derived growth factor subunit B
  KO
K17386  platelet-derived growth factor subunit B
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl04010  MAPK signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04020  Calcium signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04510  Focal adhesion
hgl04540  Gap junction
hgl04630  JAK-STAT signaling pathway
hgl04810  Regulation of actin cytoskeleton
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05200  Pathways in cancer
hgl05206  MicroRNAs in cancer
hgl05211  Renal cell carcinoma
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05231  Choline metabolism in cancer
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101698830 (Pdgfb)
   04014 Ras signaling pathway
    101698830 (Pdgfb)
   04015 Rap1 signaling pathway
    101698830 (Pdgfb)
   04630 JAK-STAT signaling pathway
    101698830 (Pdgfb)
   04020 Calcium signaling pathway
    101698830 (Pdgfb)
   04072 Phospholipase D signaling pathway
    101698830 (Pdgfb)
   04151 PI3K-Akt signaling pathway
    101698830 (Pdgfb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101698830 (Pdgfb)
   04540 Gap junction
    101698830 (Pdgfb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101698830 (Pdgfb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101698830 (Pdgfb)
   05206 MicroRNAs in cancer
    101698830 (Pdgfb)
   05231 Choline metabolism in cancer
    101698830 (Pdgfb)
  09162 Cancer: specific types
   05214 Glioma
    101698830 (Pdgfb)
   05218 Melanoma
    101698830 (Pdgfb)
   05211 Renal cell carcinoma
    101698830 (Pdgfb)
   05215 Prostate cancer
    101698830 (Pdgfb)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101698830 (Pdgfb)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101698830 (Pdgfb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101698830 (Pdgfb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101698830 (Pdgfb)
   00536 Glycosaminoglycan binding proteins [BR:hgl00536]
    101698830 (Pdgfb)
Cytokines and growth factors [BR:hgl04052]
 Growth factors
  Growth factors (RTK binding)
   101698830 (Pdgfb)
Glycosaminoglycan binding proteins [BR:hgl00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101698830 (Pdgfb)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 101698830
NCBI-ProteinID: XP_004845640
UniProt: G5AYU7
LinkDB
Position
Un
AA seq 241 aa
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDQSIRSFDDLQRLLHGDSVDEDGAEV
DLNVTRAHSGREAEGSSRGRRSLGSPTVAEPAVIAECKTRTEVFQISRNLIDRSNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRGKPTFKKATVTLEDHLACKC
ETVVSARPVTRSQGSSQEQRARTPQTRTAVRTVRVRRPPKGKHRKFKHTHDKETLKETLG
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaatcgctgttgggcgctcttcctgtctctctgctgttacctgcgcctggtcagcgcc
gagggggaccccattcccgaggaactctatgagatgctgagtgaccagtccatccgctcc
ttcgatgacctccagcgcctgctgcatggagactccgtagatgaggatggggccgaggtg
gacctgaatgtgacccgggcccactcaggacgtgaggctgaaggctcatctcgcgggagg
aggagcctgggttccccgacagtggccgagccagctgtgattgccgagtgcaagacgcgc
actgaggtgttccagatctcccggaacctcatcgaccgctccaacgccaacttcctggtg
tggccgccctgcgtggaggtgcagcgatgctccggctgctgcaacaaccgcaacgtgcaa
tgccggcccacgcaggtgcagctgcggccggtgcaggtgaggaagatcgagattgtgcgg
gggaagccgacctttaagaaggccacggtgacactggaagaccacctggcctgcaagtgt
gagacagtggtgtctgcccggcctgtgacccgaagccaggggagctcccaggagcagcga
gccaggactccccagactcggacggccgtccggacagtgcgagtccgcaggccccccaag
gggaagcaccgcaagttcaagcacacgcatgacaaggagacgctgaaagagaccctcgga
gcatag

KEGG   Heterocephalus glaber (naked mole rat): 101725739
Entry
101725739         CDS       T02812                                 

Gene name
Pdgfa
Definition
(RefSeq) platelet derived growth factor subunit A
  KO
K04359  platelet-derived growth factor subunit A
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl04010  MAPK signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04020  Calcium signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04510  Focal adhesion
hgl04540  Gap junction
hgl04630  JAK-STAT signaling pathway
hgl04810  Regulation of actin cytoskeleton
hgl05200  Pathways in cancer
hgl05202  Transcriptional misregulation in cancer
hgl05206  MicroRNAs in cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05231  Choline metabolism in cancer
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101725739 (Pdgfa)
   04014 Ras signaling pathway
    101725739 (Pdgfa)
   04015 Rap1 signaling pathway
    101725739 (Pdgfa)
   04630 JAK-STAT signaling pathway
    101725739 (Pdgfa)
   04020 Calcium signaling pathway
    101725739 (Pdgfa)
   04072 Phospholipase D signaling pathway
    101725739 (Pdgfa)
   04151 PI3K-Akt signaling pathway
    101725739 (Pdgfa)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101725739 (Pdgfa)
   04540 Gap junction
    101725739 (Pdgfa)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101725739 (Pdgfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101725739 (Pdgfa)
   05202 Transcriptional misregulation in cancer
    101725739 (Pdgfa)
   05206 MicroRNAs in cancer
    101725739 (Pdgfa)
   05231 Choline metabolism in cancer
    101725739 (Pdgfa)
  09162 Cancer: specific types
   05214 Glioma
    101725739 (Pdgfa)
   05218 Melanoma
    101725739 (Pdgfa)
   05215 Prostate cancer
    101725739 (Pdgfa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101725739 (Pdgfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101725739 (Pdgfa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101725739 (Pdgfa)
   00536 Glycosaminoglycan binding proteins [BR:hgl00536]
    101725739 (Pdgfa)
Cytokines and growth factors [BR:hgl04052]
 Growth factors
  Growth factors (RTK binding)
   101725739 (Pdgfa)
Glycosaminoglycan binding proteins [BR:hgl00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101725739 (Pdgfa)
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 101725739
NCBI-ProteinID: XP_004840370
LinkDB
Position
Un
AA seq 228 aa
MIRTTPRIRRRGLDRGPPSRKPLQSTRRLHPDRRPGFQEAEIPRELIERLARSQIHSIRD
LQRLLEIDSVGTEDALETSLRAQVPHATKHAPEKRPVPIRRKRSIEEAIPAVCKTRTVIY
EIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPK
LKEVQVRLEEHLECACATSSLNPDHREEETGRRRESGKKRKRKRLKPT
NT seq 687 nt   +upstreamnt  +downstreamnt
atgattcgcacaactcccaggataagaaggcgagggctcgaccgggggccgccttccaga
aagcccctccagagcaccaggaggctccacccggacagacggccgggctttcaggaagct
gagatcccccgggagctgatcgagcggctggctcgaagtcagatccacagcatccgggac
ctccagcgactcctggagatagactccgtaggaaccgaggatgccttggagaccagcctg
agagcccaggtgccccatgccaccaaacatgctcccgagaagcggcctgtgcccattcgg
aggaagaggagcatcgaggaagccattcccgcggtctgcaagaccaggacagtcatttac
gagatacctcggagccaggtggaccccacgtctgccaacttcctgatctggccgccgtgc
gtggaggtgaagcgctgcaccggctgctgcaacaccagcagcgtcaagtgccagccctcg
agggtccaccaccggagtgtcaaggtggccaaagtggagtatgtcaggaagaagccaaag
ttgaaagaggtccaggtgaggttagaggaacacctggagtgtgcatgtgcgacctccagc
ctgaatccagaccatcgggaagaggagacgggaaggcgtagggagtcaggtaaaaaacgg
aaaagaaaacggttaaaacccacctaa

KEGG   Heterocephalus glaber (naked mole rat): 106007527
Entry
106007527         CDS       T02812                                 

Gene name
Egf
Definition
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl04010  MAPK signaling pathway
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04020  Calcium signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04068  FoxO signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04510  Focal adhesion
hgl04540  Gap junction
hgl04630  JAK-STAT signaling pathway
hgl04810  Regulation of actin cytoskeleton
hgl05160  Hepatitis C
hgl05165  Human papillomavirus infection
hgl05200  Pathways in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05219  Bladder cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05226  Gastric cancer
hgl05231  Choline metabolism in cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106007527 (Egf)
   04012 ErbB signaling pathway
    106007527 (Egf)
   04014 Ras signaling pathway
    106007527 (Egf)
   04015 Rap1 signaling pathway
    106007527 (Egf)
   04630 JAK-STAT signaling pathway
    106007527 (Egf)
   04066 HIF-1 signaling pathway
    106007527 (Egf)
   04068 FoxO signaling pathway
    106007527 (Egf)
   04020 Calcium signaling pathway
    106007527 (Egf)
   04072 Phospholipase D signaling pathway
    106007527 (Egf)
   04151 PI3K-Akt signaling pathway
    106007527 (Egf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106007527 (Egf)
   04540 Gap junction
    106007527 (Egf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106007527 (Egf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106007527 (Egf)
   05231 Choline metabolism in cancer
    106007527 (Egf)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    106007527 (Egf)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106007527 (Egf)
   05212 Pancreatic cancer
    106007527 (Egf)
   05226 Gastric cancer
    106007527 (Egf)
   05214 Glioma
    106007527 (Egf)
   05218 Melanoma
    106007527 (Egf)
   05219 Bladder cancer
    106007527 (Egf)
   05215 Prostate cancer
    106007527 (Egf)
   05213 Endometrial cancer
    106007527 (Egf)
   05224 Breast cancer
    106007527 (Egf)
   05223 Non-small cell lung cancer
    106007527 (Egf)
  09172 Infectious disease: viral
   05160 Hepatitis C
    106007527 (Egf)
   05165 Human papillomavirus infection
    106007527 (Egf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106007527 (Egf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    106007527 (Egf)
Cytokines and growth factors [BR:hgl04052]
 Growth factors
  Growth factors (RTK binding)
   106007527 (Egf)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition EGF_CA cEGF EGF EGF_3 DUF5050 EGF_MSP1_1 hEGF Tr-sialidase_C Plasmod_Pvs28
Other DBs
NCBI-GeneID: 106007527
NCBI-ProteinID: XP_004867639
LinkDB
Position
Un
AA seq 853 aa
MKEAGPAQESRYSELASCPGSASECSHDCVLTLEGPHCFCPEGSVLEADGKTCSGCSSPG
NGGCSQLCIPLGPVSWECGCFPGYDLQLDQKSCVASGPQPLLLFANSRDIRRMHFDGTDY
EILLSQQMGTVLALDHDPVENKIYFAHTALKWIERANMDGSQRERLIEEAVDAPEGLAVD
WIGRRLYWTDRGKSVIEGSDVNGKHREIIIKENISQPRGIAVHPMAKRLFWTDVGTNPRV
ESASLQGADRRVIASSELAEPSGLTIDLLTDTLYWCDAQLSVVEMANLDGSRRQRLAQDD
VGHPFAVAVFEDHLWLSDWAAPSVTRVHKRTGQNRVRLRGSVLKPSSLVVVHPLAKPGAD
PCSHLGGACEQICQERFGTAQCSCLRGFRSALDGRTCLALRSLPPSAGGDADHSRQGTAP
DHFSGTKASEDNTTGAQRLLVAEIMVSDEDDCSPVACAVHAQCTPEGDGATCRCSEGFAG
DGELCSDVDECAADSTACPSPSSECINTEGGYVCRCSAGYRGDGLRCLDIDECQLQVHSC
GPGANCTNTEGGYTCWCAGGPSAPGLPCPESTSTPPLGEDGGGLVRNGYPGCPPSHSGFC
LHGGVCMYIEAVDTYACNCVIGYVGERCQHRDLRWWELRHAGHGQHRDVTVAAICVVALV
LLLLLGLWGARCYRCRSLGLYSEPTAACRANSAAFTHSHSRASSLVFWKIPHVRMKKLAL
KTPKNPYEESCRDVSSRRPADGEAGVSACPQPWFVVLKEDQNFRTVSHPTSGKNGQMADV
GQLPSLEPDQLPLWRQEPHICGVGTEQGRWAPLSSDKEPGPQVMERSFHLPSYVAKPLAV
GVQKPHPLQSADP
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgaaagaagctgggccagcccaggaatcccgctactcagaattagcttcctgtccgggc
agtgcatccgaatgcagccacgactgtgtcctaacattggagggcccccattgtttctgt
cctgaaggttccgtgctggaggcagacggaaagacgtgtagcggctgctcgtcacctggt
aacggtggctgtagccagctctgcattcccctcggcccggtgtcctgggagtgtggttgc
tttcctgggtacgacctgcaactggaccagaagagttgtgtggcttcaggaccacagcca
cttttgctctttgccaactctcgagacatccgacgcatgcactttgacgggacagactat
gaaatcctgctcagccagcagatgggaacggttcttgcactggatcacgacccggtggag
aataagatatattttgcccacacagccctgaagtggatagagagggctaacatggacggg
tcccagagagaaaggctcattgaggaagcagtggatgcaccagaaggtcttgctgtggac
tggattggccgtagactctactggacagacagagggaaatctgtcattgaagggagtgat
gtaaatggaaaacatcgagaaataatcattaaggaaaatatctctcagccacgaggaatt
gctgttcatcccatggccaagcgattgttctggaccgacgtggggacgaatccacgagtg
gaaagcgcttccctgcagggcgctgaccggcgggttatcgccagctcagagctggcggag
cctagcggactcactatcgacctcctgaccgacaccctgtactggtgcgatgcccagctg
tctgtggtcgagatggccaatctggatggctccaggcgccagaggctggcccaggacgat
gtaggccacccgtttgccgtggctgtgttcgaggaccacctgtggctgtcggactgggcc
gcgccgtcggtaacgagggtgcacaagaggactggccaaaacagggtacgtctgcgaggc
agcgtgctgaagccctcctcgctggttgtggttcacccactggcaaaaccaggcgcggac
ccctgctctcacctgggtggcgcctgcgagcagatctgccaggagaggttcgggaccgct
cagtgttcctgtctcagaggtttccggagcgccctggacgggaggacgtgcctggctctg
aggagtctcccgccttcggccggtggtgacgctgatcacagtcggcaggggacagcacca
gaccacttttctgggactaaggcatcagaagacaacaccacaggagctcagcgcctgcta
gtggccgaaatcatggtgtcagatgaggatgactgttcccctgtggcgtgtgccgtgcac
gctcagtgcactccggagggcgacggcgccacctgccggtgttcggaggggttcgctggg
gatggagaactatgctcggatgtagacgaatgtgcggcggacagcaccgcctgcccttcc
ccctcctccgagtgcatcaacacggaaggcggctacgtgtgcaggtgctcggccgggtac
cgcggagacgggctacgctgtctggacatcgatgagtgccagctgcaggtgcacagctgc
gggccaggagccaactgcacaaacacggagggtggctacacctgctggtgcgccggcggc
ccttctgcgcccgggctgccctgtcctgagtcgacctcaacccctccccttggggaagat
ggcggcggtctggtcagaaatggttacccgggatgtcccccctcacacagcgggttctgc
ctccacggcggagtgtgcatgtacatcgaagcagtagacacctacgcctgcaactgtgtc
atcggctacgtcggggagcgctgccagcaccgagacctcagatggtgggagctgcgccac
gccggccacgggcagcatcgggacgtcacggtggcagccatctgtgtggtggcgctggtc
ctgctgctcctcctggggctgtggggggcacgctgctacaggtgcaggtctctgggatta
tacagtgaacccactgccgcctgcagagccaactcagccgcatttacccacagccactcc
agggccagcagcctcgtgttctggaagattccacacgtcaggatgaagaagctggcgctg
aaaaccccgaagaatccttatgaggagtcgtgcagagacgtgagcagtcggaggccggcc
gacggcgaggctggggtgtctgcctgcccccaaccttggttcgtggtcttaaaggaagat
cagaacttcaggactgtgagtcatcctacgtctggcaagaatggccagatggcagatgtt
ggccagcttccctccctggagcctgatcaactgcctttgtggagacaggagccccacata
tgtggagtgggcacagagcaaggccgctgggccccactgtccagcgataaggaacctggt
ccccaggtcatggagcgaagctttcatctcccctcctatgtggcaaagcccctcgctgtg
ggggttcagaagccccatcctctccagtcagctgacccatga

DBGET integrated database retrieval system