KEGG   Heterocephalus glaber (naked mole rat): 101698963
Entry
101698963         CDS       T02812                                 

Gene name
E2f3
Definition
(RefSeq) E2F transcription factor 3
  KO
K06620  transcription factor E2F3
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01522  Endocrine resistance
hgl04110  Cell cycle
hgl04218  Cellular senescence
hgl04934  Cushing syndrome
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05163  Human cytomegalovirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05169  Epstein-Barr virus infection
hgl05200  Pathways in cancer
hgl05206  MicroRNAs in cancer
hgl05212  Pancreatic cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05219  Bladder cancer
hgl05220  Chronic myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101698963 (E2f3)
   04218 Cellular senescence
    101698963 (E2f3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101698963 (E2f3)
   05206 MicroRNAs in cancer
    101698963 (E2f3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101698963 (E2f3)
   05225 Hepatocellular carcinoma
    101698963 (E2f3)
   05226 Gastric cancer
    101698963 (E2f3)
   05214 Glioma
    101698963 (E2f3)
   05220 Chronic myeloid leukemia
    101698963 (E2f3)
   05218 Melanoma
    101698963 (E2f3)
   05219 Bladder cancer
    101698963 (E2f3)
   05215 Prostate cancer
    101698963 (E2f3)
   05224 Breast cancer
    101698963 (E2f3)
   05222 Small cell lung cancer
    101698963 (E2f3)
   05223 Non-small cell lung cancer
    101698963 (E2f3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101698963 (E2f3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101698963 (E2f3)
   05161 Hepatitis B
    101698963 (E2f3)
   05160 Hepatitis C
    101698963 (E2f3)
   05163 Human cytomegalovirus infection
    101698963 (E2f3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101698963 (E2f3)
   05169 Epstein-Barr virus infection
    101698963 (E2f3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101698963 (E2f3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hgl03000]
    101698963 (E2f3)
Transcription factors [BR:hgl03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    101698963 (E2f3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 101698963
NCBI-ProteinID: XP_012928736
LinkDB
Position
Un
AA seq 353 aa
MDSSQKVNPGKRTPQMNSQAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKS
PSEKTRYDTSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIK
KKSKNNVQWMGCSLSEDGGMLAQCQGLSREVTELSQEEKKLDELIQSCTLDLKLLTEDSE
NQRLAYVTYQDIRKISGLKDQTVIVVKAPPETRLEVPDSVESLQIHLASTQGPIEVYLCP
EETETHSPMKTNNQDHNGNIPKPTSKDLASNNSGHNDCSISMANLSPLASPANLLQQTED
QIPSNLEGPFVNLLPPLLQEDYLLSLGEEDGISDLFDAYDLEKLPLVEDFMCS
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggattcgtcgcagaaagttaaccctggtaaaaggacaccgcagatgaattctcaggca
aagcgaaggctggagctaggagaaagcggtcatcagtacctctcagatggtttaaaaacc
cccaagggcaaaggaagagctgcactacgaagtccagatagcccgaaaactccaaaatct
ccctcagaaaaaacacggtatgacacgtcccttggtctgctcaccaagaagttcattcag
ctcctgagccagtcacccgatggggtcttggacttgaataaggcagcagaggtgctcaaa
gtgcaaaagaggagaatctacgacatcaccaacgtgctggaaggcatccatctcatcaag
aagaagtccaagaacaacgtccagtggatgggctgcagtctgtctgaggatgggggcatg
ctggcccagtgtcaaggcctgtccagagaagtgaccgagctcagtcaggaggagaagaag
ttagatgaactgatccaaagctgcaccctggacctcaaactgttaaccgaggattcagag
aatcaaaggttagcttatgttacctatcaagatattcgaaaaattagtggccttaaagac
caaactgttatagttgtgaaagcccctccagaaacaagacttgaagtgcctgactccgta
gagagcctacaaatccatttggcaagtacccaaggacccattgaggtttacttgtgtccg
gaagagactgaaacacacagtccaatgaaaacaaacaaccaagaccacaatgggaacatc
cctaaacccacttccaaagacttggcttcaaataactcaggacataacgattgctcaatt
tctatggcaaacctttctcctctggcctccccagctaaccttttacagcagactgaggac
caaatcccttccaacctggaggggccatttgtgaacttactgcctcccctacttcaagag
gactacctgctgagcctgggtgaggaagatggcatcagcgatctctttgatgcctatgat
ttggaaaagctcccattggtggaagactttatgtgtagttga

KEGG   Heterocephalus glaber (naked mole rat): 101711793
Entry
101711793         CDS       T02812                                 

Gene name
E2f2
Definition
(RefSeq) E2F transcription factor 2
  KO
K09389  transcription factor E2F2
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01522  Endocrine resistance
hgl04110  Cell cycle
hgl04218  Cellular senescence
hgl04934  Cushing syndrome
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05163  Human cytomegalovirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05169  Epstein-Barr virus infection
hgl05200  Pathways in cancer
hgl05206  MicroRNAs in cancer
hgl05212  Pancreatic cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05219  Bladder cancer
hgl05220  Chronic myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101711793 (E2f2)
   04218 Cellular senescence
    101711793 (E2f2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101711793 (E2f2)
   05206 MicroRNAs in cancer
    101711793 (E2f2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101711793 (E2f2)
   05225 Hepatocellular carcinoma
    101711793 (E2f2)
   05226 Gastric cancer
    101711793 (E2f2)
   05214 Glioma
    101711793 (E2f2)
   05220 Chronic myeloid leukemia
    101711793 (E2f2)
   05218 Melanoma
    101711793 (E2f2)
   05219 Bladder cancer
    101711793 (E2f2)
   05215 Prostate cancer
    101711793 (E2f2)
   05224 Breast cancer
    101711793 (E2f2)
   05222 Small cell lung cancer
    101711793 (E2f2)
   05223 Non-small cell lung cancer
    101711793 (E2f2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101711793 (E2f2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101711793 (E2f2)
   05161 Hepatitis B
    101711793 (E2f2)
   05160 Hepatitis C
    101711793 (E2f2)
   05163 Human cytomegalovirus infection
    101711793 (E2f2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101711793 (E2f2)
   05169 Epstein-Barr virus infection
    101711793 (E2f2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101711793 (E2f2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hgl03000]
    101711793 (E2f2)
Transcription factors [BR:hgl03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    101711793 (E2f2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 101711793
NCBI-ProteinID: XP_012929640
LinkDB
Position
Un
AA seq 439 aa
MLRGPRALAPAVTQPPKGVPALSPTELWPPGLGSPQLCPATTTYYTSLFPQTVPPAAAPG
TCLDATPHGPDGQAVRCVPAGRLPAKRKLDLESIGRPAVPEFRTPKGKGFRVDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKSKNNIQWVGRGLFEDPTRPVKQQQLGQELKDLTSTEQALDQLIQSCSLSFKHLTE
DTANKRLAYVTYQDIRAMGNFKEQTVIAVKAPPQTRLEVPDKAEENLQIYLKSTQGPIEV
YLCPEEVQEPDSPAEEPLPSTSPLSPSPDCTLPTTSADPGVSEPAASSAPAPTPRQDPLP
PPPPPSLIPLEATDSMLELTHPLLQQTEDQFLSPTLPCNSPLISFSPPLDQDDYLWGLDS
GEGVSDLFDSYDLGDLLIN
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgctgcgcgggccccgggccctggccccagccgttacgcagccccccaagggggtgccc
gctttgagtcccactgagctgtggccgcccggccttggcagcccccagctctgcccagcc
accaccacctactacacctcgctgttcccgcagacggtgcctcccgctgcagcgccgggc
acctgcctcgacgccaccccccacggacctgacggccaagctgtgcgctgcgtgccggcc
ggccggctgccggccaaaaggaagctggatctggagagtatcgggaggcctgcagtccct
gaattccggactcccaaggggaagggcttccgagtggacggccttcctagccccaaaaca
cccaagtcccctggagagaagactcggtatgacacatcgctggggctgctcaccaagaag
ttcatttacctcctgagcgagtcagaggatggggtcctggacctgaactgggcagctgag
gtgctagatgtgcagaagcgtcgcatctatgacatcaccaatgtactggagggcatccag
ctcatccgcaagaagtccaagaacaacatccagtgggtaggaaggggactatttgaagac
cccaccaggcctgtgaagcagcaacagctgggacaggagctgaaggatctgacaagcacc
gagcaggccttggaccagctcatccagagctgttccctcagcttcaagcacctgaccgag
gatacagccaacaagaggctggcctatgtgacttaccaagacatccgcgccatgggcaac
tttaaggagcagacggtgatcgctgtcaaggcccctccacagacaagactggaagtgcca
gacaaagctgaggagaacctgcagatatatctgaagagcacccaggggcccattgaagtc
tacctgtgcccggaggaggtgcaggagcctgacagtccagccgaggagcctctcccttcc
acctcccccctcagccccagccctgactgcaccctgcctaccaccagcgccgaccctggg
gtctcagagcctgcagcctcctcagcgccagcgccaactccccggcaggacccactgcca
ccgccaccaccaccatccctcatccctttggaggccactgacagtatgctggagctgaca
catccccttctacagcagactgaggaccagttcctgtctccaaccctgccctgcaactcc
cctctgatcagcttctccccacctctggaccaggacgactacctgtggggcctggacagc
ggtgagggcgtcagtgacctctttgactcctatgacctcggggacctgctgattaattga

KEGG   Heterocephalus glaber (naked mole rat): 101717980
Entry
101717980         CDS       T02812                                 

Gene name
E2f1
Definition
(RefSeq) E2F transcription factor 1
  KO
K17454  transcription factor E2F1
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01522  Endocrine resistance
hgl04110  Cell cycle
hgl04137  Mitophagy - animal
hgl04218  Cellular senescence
hgl04934  Cushing syndrome
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05163  Human cytomegalovirus infection
hgl05165  Human papillomavirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05169  Epstein-Barr virus infection
hgl05200  Pathways in cancer
hgl05206  MicroRNAs in cancer
hgl05212  Pancreatic cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05219  Bladder cancer
hgl05220  Chronic myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101717980 (E2f1)
  09143 Cell growth and death
   04110 Cell cycle
    101717980 (E2f1)
   04218 Cellular senescence
    101717980 (E2f1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101717980 (E2f1)
   05206 MicroRNAs in cancer
    101717980 (E2f1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101717980 (E2f1)
   05225 Hepatocellular carcinoma
    101717980 (E2f1)
   05226 Gastric cancer
    101717980 (E2f1)
   05214 Glioma
    101717980 (E2f1)
   05220 Chronic myeloid leukemia
    101717980 (E2f1)
   05218 Melanoma
    101717980 (E2f1)
   05219 Bladder cancer
    101717980 (E2f1)
   05215 Prostate cancer
    101717980 (E2f1)
   05224 Breast cancer
    101717980 (E2f1)
   05222 Small cell lung cancer
    101717980 (E2f1)
   05223 Non-small cell lung cancer
    101717980 (E2f1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101717980 (E2f1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101717980 (E2f1)
   05161 Hepatitis B
    101717980 (E2f1)
   05160 Hepatitis C
    101717980 (E2f1)
   05163 Human cytomegalovirus infection
    101717980 (E2f1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101717980 (E2f1)
   05169 Epstein-Barr virus infection
    101717980 (E2f1)
   05165 Human papillomavirus infection
    101717980 (E2f1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101717980 (E2f1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hgl03000]
    101717980 (E2f1)
Transcription factors [BR:hgl03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    101717980 (E2f1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 101717980
NCBI-ProteinID: XP_004867990
LinkDB
Position
Un
AA seq 431 aa
MAVAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPAAPAAGPGDPDLLL
FATPQAPRPPPSAPRPALGRPPVKRRLDLETDHQYLAESSGPVRGRGRHLGKGVKSPGEK
SRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSK
NHIQWLGSHTTVGISGRLEGLTQDLRQLQESEQQLDHLMHICTTQLQLLSEDSDSQRLAY
VTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSETFQISLKSKQGPIDVFLCPEESAGG
ISPAKTPSQEAASGEEDRTGDTVTPVPPPSSPPSSPAMDPSQSLLSLEQEPLLSRMSGLR
APVDEDHLSPLVAADSLLEHVREDFPGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFD
CDFGDLTPLDF
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggccgtggcccccgcgggcggcccatgcgcgccggcgctggaggccctgctcggggcc
ggcgcgctgcggctgctcgactcttcgcaaatcgtcatcatctccgcagcgcaggacgcc
agcgccccgccggcccccgctgcgcctgccgccggccccggcgaccctgacctgctgctc
ttcgccacgccgcaggcgccccggcccccacccagcgcgccgcgcccagctctcggccgc
ccgccggtgaagcggaggctggacctggaaactgaccaccagtacctggctgagagcagt
gggccagtccggggcagaggccggcacctggggaaaggtgtgaaatccccaggggagaaa
tcgcgctatgagacatcactgaatctaaccaccaaacgcttcctggagctgctgagccgc
tcagctgatggcgttgtcgacctgaactgggcagccgaggtgctgaaggtgcagaaacga
cgcatctatgatatcaccaacgtcctggagggcatccagctcattgccaagaagtctaag
aaccacatccagtggctgggcagccataccacagtggggatcagcgggcggcttgaaggg
ctgacccaggacctccggcagctgcaggagagcgagcagcaacttgaccacctaatgcac
atctgtaccacacagctgcagctgctctctgaggactctgacagccagcgcctggcctat
gtgacctgccaggaccttcgtagcatcgcagaccctgcagagcagatggtcatggtgatc
aaggcccctccagagacccagctccaagctgtggattcttcagagacctttcagatctcc
cttaagagcaaacaaggccccattgatgttttcctgtgccctgaggagagtgcaggtgga
atcagccctgcaaagaccccgtcccaggaggcagcttctggggaagaggataggacaggt
gatactgtcaccccagtgccaccaccatcatctcccccctcctctcctgccatggatccc
agccagtccctcctcagcctggagcaagagccattgctgtcacggatgagtggcctacgg
gcccctgtggatgaggatcacctgtccccgttggtcgctgctgactcactcctggagcat
gtgcgggaggactttcctgggctccttcctgaggagttcatcagcctctccccaccccat
gaggccctcgactaccattttggccttgaggagggcgagggcatcagagacctctttgat
tgtgacttcggagacctgacccccctggatttctga

DBGET integrated database retrieval system