KEGG   Heterocephalus glaber (naked mole rat): 101699097Help
Entry
101699097         CDS       T02812                                 

Gene name
Tgm2
Definition
(RefSeq) transglutaminase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    101699097 (Tgm2)
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101699097 (Tgm2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core A2M_N
Motif
Other DBs
NCBI-GeneID: 101699097
NCBI-ProteinID: XP_004867843
UniProt: A0A0N8EU87
LinkDB All DBs
Position
Un
AA seq 691 aa AA seqDB search
MAEDLVLERCDLQLEVNGRDHRTADLCRERLVLRRGQPFWLTLHFEGRGYEASVDTLTFS
AVTGPAPSEEAGTKARFSLSDAVDGCAWSASAVDQQDGVLSLLLNTPADAPIGLYRLSLE
ASTGYQGSSFVLGHFTLLFNAWCPADTVYVDSDQERQEYVLTQQGFIYQGSAKFIKSTPW
NFGQFEDGILDICLILLDVNPKFLKDAGRDCSRRRSPIYVGRVVSAMVNCNDDQGVLLGR
WDNNYGDGISPMSWIGSVEILRRWKDYGCQRVKYGQCWVFAAVACTVLRCLGVPTRVVTN
YNSAHDQNSNLLIEYFRNESGETEGNKSEMIWNFHCWVESWMTRPDLEPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGNLSIKYDAPFVFAEVNADVVDWIRQEDGSLHKSINHSL
VVGLKISTKSVGRDEREDITHTYKYPEGSEEEREAFTRANHLNKLAEKEEVKEEAQVDMR
IRVGQNMNMGSDFDVFAHINNSTAESRDCRLLLCARTVSYNGVLGPECGTKDLPDLTLDP
FSERSIPLHILYEKYSDYLTECNLIKVRGLLIEPAANSYVLAERDLYLENPEVKIRVLGE
PKQNRKLVAEVSLKNPLPVPLLGCIFTVEGAGLTKEQKSVEVPGPVESGEQVKVRVDLLP
TDVGLHKLVVNFECDRLKAVKGYRNVIIGPP
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggatctggtcctggagagatgtgacttgcagctagaggtcaatggccgagac
caccgcacggccgacctgtgccgggagaggctggtgttgcggcggggccagcccttctgg
ctgacgctgcacttcgagggccgaggctatgaagccagtgtggacaccctcaccttcagc
gctgtgaccggcccagcccccagcgaagaggccgggaccaaggctcgcttctcgctgtcc
gatgctgtggatgggtgtgcctggtcagcctcagcggtggaccagcaggatggtgtcctc
tcgctgctgctcaacaccccggctgacgcccccattggcctatatcgcctcagtctggaa
gcctccacaggctaccagggctccagcttcgtgttggggcacttcaccctgctcttcaat
gcctggtgcccagcggacactgtctacgtggactcagaccaggagcggcaggagtatgtg
ctcacccagcagggcttcatctaccagggctcggccaagttcatcaagagtacaccttgg
aactttgggcagtttgaagatgggatcctggatatttgcctgatcctcttggatgtcaac
cccaagttcctgaaggacgctggccgtgactgctcacgccgcagaagccccatctatgtg
ggccgggtggtgagtgcaatggtcaactgcaatgatgaccagggcgtgctcctgggacgc
tgggacaacaactatggggatggcatcagccccatgtcttggatcggcagcgtggagatc
ctgaggcgctggaaggactacggatgccagcgcgtcaaatacggccagtgctgggtcttc
gctgccgtggcctgcacagtgctgcgctgcctcggggtccccacccgagtcgtgaccaac
tataactcagcccatgaccagaacagcaacctgcttatcgagtacttccgcaacgaatct
ggggagaccgaggggaacaaaagcgagatgatctggaacttccactgctgggtggagtcg
tggatgaccaggccggacctggagcccgggtacgaggggtggcaggccctggaccccaca
ccccaggagaagagcgaagggacatactgctgcggcccagtcccagttcgtgccatcaag
gagggcaacctgagcatcaagtacgacgcacctttcgtgtttgcggaggtcaacgctgac
gtggtggactggatccgccaggaggatgggtccctgcacaagtccatcaaccattccctg
gtcgtggggctgaagatcagcactaagagtgtgggccgtgatgagcgggaggacatcacc
cacacctacaagtacccagaggggtctgaagaggagagggaagctttcacaagggccaac
cacctgaacaaactggctgagaaggaggaggtaaaggaggaagcacaggtggacatgcgg
atccgcgtgggccagaacatgaatatgggcagtgactttgatgtctttgcccacatcaac
aacagcaccgctgagagcagagactgccgcctcctgctctgcgcgcgcactgtcagctac
aatggggtcctggggccggagtgtggcaccaaggacctgcctgacctgaccctggatccc
ttctcggagaggagcattcctctgcacatcctctatgagaagtacagcgactacctgacc
gagtgcaacctcatcaaggtgcggggcctcctcatcgagccagcagccaacagctacgtg
ctggctgagagggacctctacctggagaatccagaagtgaagatccgcgtcctaggggag
cccaagcagaaccgcaagctggtggcggaggtgtccctgaagaacccgctccctgtgcca
ctgctgggttgcatcttcactgtggagggcgctggcctgaccaaggagcagaagtccgtg
gaggtcccgggccccgtggaatcaggggagcaggtgaaggtgcgggtggacctgctgccg
acagatgtgggcctccacaagctggtggtgaacttcgagtgtgacaggctgaaggcggtg
aagggttatcggaatgtcatcattgggcccccgtag

DBGET integrated database retrieval system