KEGG   Heterocephalus glaber (naked mole rat): 101699253
Entry
101699253         CDS       T02812                                 

Gene name
Ralb
Definition
(RefSeq) RAS like proto-oncogene B
  KO
K07835  Ras-related protein Ral-B
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl05200  Pathways in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101699253 (Ralb)
   04015 Rap1 signaling pathway
    101699253 (Ralb)
   04072 Phospholipase D signaling pathway
    101699253 (Ralb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101699253 (Ralb)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101699253 (Ralb)
   05212 Pancreatic cancer
    101699253 (Ralb)
Membrane trafficking [BR:hgl04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    101699253 (Ralb)
GTP-binding proteins [BR:hgl04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    101699253 (Ralb)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase SRPRB GTP_EFTU MMR_HSR1 Gtr1_RagA AAA_25 FeoB_N AAA_24 Ser_hydrolase
Other DBs
NCBI-GeneID: 101699253
NCBI-ProteinID: XP_004836105
UniProt: A0A0P6JCL2
LinkDB
Position
Un
AA seq 206 aa
MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDK
IPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRAKK
MSENKDKNGKKSSKNKKSFKERCCLL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctgcaaacaagagcaagggccagagcagcttggccctgcacaaagtgatcatggtt
ggcagtggaggggtcggcaagtcggccctgacacttcagttcatgtatgatgagtttgta
gaagactatgaacctaccaaagctgacagttacagaaagaaagtggttcttgatggtgaa
gaagtccagatcgatattctggacacagctggacaagaagactatgctgccattcgagac
aactacttccggagtggggaaggatttctgcttgtgttttcaatcacggaacacgaatcc
ttcacagcaactgctgagttcagggaacagatcctccgagtgaaggctgaagaggataaa
attccattgctggtcgtgggaaacaagtctgacttggaggagcggaggcaggtacccgtc
gaggaggccaggagcaaagcagaagagtggggcgtgcagtacgtggagacatcagccaag
acgagggccaatgtggacaaggtgttcttcgacctaatgagagaaatcagagcaaagaag
atgtcagaaaacaaagacaagaatggcaagaaaagcagcaagaataagaaaagctttaaa
gaaagatgctgcttgctgtga

KEGG   Heterocephalus glaber (naked mole rat): 101706563
Entry
101706563         CDS       T02812                                 

Gene name
Rala
Definition
(RefSeq) RAS like proto-oncogene A
  KO
K07834  Ras-related protein Ral-A
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl05132  Salmonella infection
hgl05200  Pathways in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101706563 (Rala)
   04015 Rap1 signaling pathway
    101706563 (Rala)
   04072 Phospholipase D signaling pathway
    101706563 (Rala)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101706563 (Rala)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101706563 (Rala)
   05212 Pancreatic cancer
    101706563 (Rala)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101706563 (Rala)
Membrane trafficking [BR:hgl04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    101706563 (Rala)
GTP-binding proteins [BR:hgl04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    101706563 (Rala)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 AAA_25 MMR_HSR1_Xtn ThiF ATP_bind_1
Other DBs
NCBI-GeneID: 101706563
NCBI-ProteinID: XP_004840315
UniProt: G5B6U4
LinkDB
Position
Un
AA seq 206 aa
MATNKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV
PFLLVGNKSDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRARKM
EDSKEKNGKKKRKSLAKRIRERCCIL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggccacaaataagcccaagggtcagaactctttggccctacataaagtcatcatggtg
ggcagtggtggtgtgggcaaatcggccctgaccctgcagttcatgtatgatgagtttgtg
gaggactatgagcctaccaaagcagacagctacaggaagaaggtcgtgctggatggagaa
gaagtgcagatcgatatcttggatacagctgggcaggaggactatgctgcaatcagagac
aactacttccggagcggggagggcttcctctgtgtcttctctattacagaaatggaatcc
tttgcagccaccgccgacttcagggagcagattttaagagtaaaggaagatgaaaatgtt
ccttttctactggttggtaacaagtcagatttagaagataaaaggcaggtttcagtagaa
gaggcaaaaaacagagccgatcagtggaatgtgaactatgtggaaacatctgctaagaca
cgagctaacgtggacaaggtattttttgatttaatgagggaaattcgagccagaaagatg
gaagacagcaaagaaaagaatggaaaaaagaagaggaaaagtttagccaagagaatcaga
gaaagatgctgcattttataa

DBGET integrated database retrieval system