KEGG   Heterocephalus glaber (naked mole rat): 101699617
Entry
101699617         CDS       T02812                                 

Gene name
Nos2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00220  Arginine biosynthesis
hgl00330  Arginine and proline metabolism
hgl01100  Metabolic pathways
hgl04020  Calcium signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04146  Peroxisome
hgl04371  Apelin signaling pathway
hgl04926  Relaxin signaling pathway
hgl05010  Alzheimer disease
hgl05014  Amyotrophic lateral sclerosis
hgl05022  Pathways of neurodegeneration - multiple diseases
hgl05133  Pertussis
hgl05140  Leishmaniasis
hgl05142  Chagas disease
hgl05145  Toxoplasmosis
hgl05146  Amoebiasis
hgl05152  Tuberculosis
hgl05200  Pathways in cancer
hgl05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    101699617 (Nos2)
   00330 Arginine and proline metabolism
    101699617 (Nos2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101699617 (Nos2)
   04066 HIF-1 signaling pathway
    101699617 (Nos2)
   04020 Calcium signaling pathway
    101699617 (Nos2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101699617 (Nos2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101699617 (Nos2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101699617 (Nos2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101699617 (Nos2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101699617 (Nos2)
   05014 Amyotrophic lateral sclerosis
    101699617 (Nos2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101699617 (Nos2)
   05152 Tuberculosis
    101699617 (Nos2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101699617 (Nos2)
   05145 Toxoplasmosis
    101699617 (Nos2)
   05140 Leishmaniasis
    101699617 (Nos2)
   05142 Chagas disease
    101699617 (Nos2)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     101699617 (Nos2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 101699617
NCBI-ProteinID: XP_004857022
LinkDB
Position
Un
AA seq 1148 aa
MREGLSAACEAARPRLYRFLRRILPPKPTRCLRASPETQDDPKYCSPSKRQNGSSQPLLG
MAKKTPESQSKPHEPSQTCPQHMRIKNWGSGMILQDTLHNKAKTNFTCKSKSCLGSIMNP
RSLTRGPRDKPTPLDELLPQAIEFVNQYYDSFKEAKIEEHLARVEAVTKEIETTGTYQLT
GDELIFATKLAWRNAPRCIGRIQWSNLQVFDARSCTTAQEMFEHICRHLRYATNNGNIRS
AITVFPQRTDGKRDFRIWNAQLIRYAGYQMPDGTIRGDPANLEFTQLCIDLGWKPHYGRF
DVLPLVLQADGRDPELFEIPRDLVLEVPMEHPKYEWFQELGLKWYALPAVANMLLEVGGL
EFPGCPFNGWYMGTEIGVRDFCDAQRYNILEEVGRRMGLETHTLASLWKDRAVTEINVAV
LHSFQKQNVTIMDHHSAAESFMKHMQNEYRTRGGCPADWIWLVPPMSGSITPVFHQEMLN
YILSPFYYYQVDAWKTHVWQDEKRRPRRREIPFRVLARAVLFASVLMHKTMASRVRATIL
FATETGKSEALAQDLGALFSCAFNPKVLCMDEYRLSTLEEEQLLLVVTSTFGNGDCPGNG
ETLKKSLFILKKLTNTFRYAVFGLGSSMYPRFCAFAHDIDLKLSQLGASQLTPVGEGDEL
SGQEDAFRTWAVQTFKAACEAFDVRGKHHIQIPKLYTSTVTWEPHHYRLVQDLQPLDLNK
ALSRLHAKDVFTMRLKSQQNLQSPKSSRTTLLVELSCEDSRGLAYLPGEHLGVFPCNQPA
LVQGVLERVVDSLGAHNIMRLEALDDSGSYWVKAKRLPPCSLSQALTYFLDITTPPTQLQ
LQKLARLATEQAERQRLETLSQPSEYNKWKFTNSPTFLEVLEEFPSLRVPAAFLLSQLPI
LKPRYYSISSSPDHTPSEVHLTVAVVAYRTQDARGPLHRGVCSTWLSNLKPQDPVPCFVR
RVSSFQLPKDPSHPCILIGPGTGIAPFRSFWQQRLHNSEHKGLQGGRMTLVFGCRHPDED
HIYKEEMLQMARKGVLHEVHTAYSRLPGKPKVYVQDILRQQLAGEVLRVLHEEPGHLYVC
GNVLMAQDVAYTLKQLVAAKLNLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEVKKDRAE
RPPGDIKL
NT seq 3447 nt   +upstreamnt  +downstreamnt
atgcgtgaggggctgagcgcggcgtgtgaggccgcgcggccgcggctctacaggttcctg
cgcaggatcctcccaccaaagcccacgcgatgcctccgagctagcccagaaacacaggat
gaccccaaatattgcagccctagcaagcgccaaaatggatcctcccagccccttctgggg
atggctaagaagactccagaatcccagagcaagccacatgagccttcacagacctgcccc
cagcacatgaggatcaaaaactggggcagtgggatgattttgcaagacacactccacaac
aaggccaaaacgaattttacttgcaagtccaaatcttgcctggggtccatcatgaaccca
agaagtttgaccagaggacccagggacaagcctacccctctggatgaacttctacctcaa
gctatagaatttgtcaaccagtattatgactccttcaaagaggcaaaaatagaggaacat
ctggccagggtggaagcagtaacaaaggagatagaaacaacaggaacctaccagctgaca
ggagatgagctcatcttcgccaccaagcttgcctggcgtaacgccccccgctgcattggg
aggatccagtggtccaacctgcaggtcttcgatgcccgcagctgtaccacagcccaggag
atgtttgaacacatctgcagacacctgcgctatgctaccaacaatggcaacatcaggtcg
gccatcaccgtgttcccccagcggactgatgggaagcgtgacttccgcatctggaatgct
cagctcatccggtatgctggctaccagatgccagatggcaccatcagaggggaccctgcc
aacctggagttcactcagctgtgcattgacctgggctggaagccccactacggccgcttc
gatgtgctgcctctggtcctgcaggctgacggccgtgacccagaactctttgaaatccca
cgggatcttgtgcttgaggtgcccatggaacatcccaagtacgagtggttccaggagctg
gggctgaagtggtatgccctgcccgcagtggccaacatgctgctcgaggtgggtggcctc
gagttcccagggtgccccttcaatggctggtacatgggcacagagattggcgtccgggac
ttctgtgatgctcagcgctacaacatcctggaggaggtgggcaggaggatgggcctggag
acacacacactggcctccctctggaaagaccgcgctgtcacggagatcaacgttgctgtg
ctccatagcttccagaagcagaatgtgaccatcatggaccaccactctgcagcagagtcc
ttcatgaaacacatgcagaacgagtaccggacccgtgggggctgcccagctgactggatt
tggctggtccctccaatgtcggggagcatcacccccgtgtttcaccaggagatgctgaac
tacatcctgtccccattctactactatcaggtggacgcctggaagacccacgtgtggcag
gacgagaagcggagacccaggagacgagagatcccgttcagagtcttggcgagagctgtg
ctctttgcctctgtgctgatgcacaagacaatggcatcccgagtcagagccacaatcctc
tttgccacggagacgggaaagtcagaagcgctggcccaggacctgggggccttgttcagc
tgtgccttcaatcccaaggttctctgcatggatgagtacaggctgagcacgttggaggag
gagcagctgctgctggtggtgaccagcacgtttgggaacggagactgccctggcaatgga
gagacactgaagaaatccctcttcatcctgaaaaagctcaccaacaccttcaggtatgct
gtgttcggccttggctccagcatgtatcctcgcttctgtgccttcgctcatgacatcgac
ctgaagttgtcccagctgggggcctctcagctcaccccagtgggggaaggggatgagctc
agcgggcaggaggatgccttccgcacctgggctgtgcaaaccttcaaggcagcctgtgag
gcatttgatgttcgaggcaaacaccacatccagatccccaagctctacacatccaccgtg
acctgggagccacaccactacaggctggtgcaggacttgcagcctttggacctcaacaaa
gccctcagtaggctgcatgccaaggacgtgttcaccatgaggctcaaatctcagcagaat
cttcagagtccaaaatccagccgcaccaccctcctggtggaactctcctgtgaggacagc
cgaggcctggcttacctgcccggggagcaccttggggttttcccatgcaaccagccggcc
ctggtccaaggcgtcttggagcgagtggtggacagcctaggagcccacaacatcatgcgc
cttgaggccctggatgacagcgggagctactgggtcaaggccaagaggctgccaccctgc
tcacttagccaggccctcacctacttcctggacatcaccacccccccaacccagctgcag
ctccagaagctggcccggctggccacagaacaggctgagagacagagactggagactctg
agccagccctcagagtacaacaaatggaagttcaccaacagccccacgttcctggaggtg
ctggaggagttcccgtcgctgcgggtgcccgctgccttcctgctctcccagctccccatt
ctgaagccccgctactactccatcagctcctccccggaccacactccctcagaggtgcac
ctcacggtggccgtggtcgcctaccgcacccaagatgcccggggccccctgcaccgtggc
gtgtgcagtacatggctcagcaacttgaagccccaggacccggtgccctgctttgtgcgg
agggtcagcagcttccagctccccaaggacccctcccatccttgcatcctcattgggccc
ggcacaggcatcgctcccttccgaagtttctggcagcagcgtctccacaactctgagcac
aaagggctccagggtggccgaatgaccctggtgtttgggtgtcgtcacccagacgaggac
cacatctataaggaggagatgctgcagatggcccggaagggggtgctgcatgaagtgcac
acagcctactccaggctgcctgggaaacccaaggtctatgttcaagacatcctgcggcag
cagctggctggagaggtgctccgtgtgctccacgaggagccaggccacctctatgtgtgt
gggaacgtgctcatggcccaggacgtggcctacactctgaagcagctggtggctgccaag
ctgaacttgaatgaggagcaggttgaggactacttcttccagctcaagagccagaagcgc
tatcatgaagatatctttggtgctgtctttccctacgaggtgaagaaggaccgggcagag
cggccacctggcgacatcaagctctga

DBGET integrated database retrieval system