KEGG   Heterocephalus glaber (naked mole rat): 101699952
Entry
101699952         CDS       T02812                                 

Gene name
Pias3
Definition
(RefSeq) protein inhibitor of activated STAT 3
  KO
K16064  E3 SUMO-protein ligase PIAS3 [EC:2.3.2.-]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04120  Ubiquitin mediated proteolysis
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101699952 (Pias3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101699952 (Pias3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hgl04121]
    101699952 (Pias3)
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     101699952 (Pias3)
Ubiquitin system [BR:hgl04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   101699952 (Pias3)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 101699952
NCBI-ProteinID: XP_004853964
LinkDB
Position
Un
AA seq 625 aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKEL
YRRRFPRKSLGPSDLSMLSLPPGTSPVGSPGPLAPIPPALLAPGTLLGPKREVDMHPPLP
QPVHPDVTMKPLPFYEVYGELIRPTTLASTSSHRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSR
PINITPLARLSATVPNTVVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILNSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSPVQEGNPSESKKKVEVIDLTIESSSDEEDLPPTKKHCPVTSAAIPALPG
SKGVLTSSHQPSSVLRSPAMGTLGSDFLSSLPLHEYPPAFPLGPDIQGLDLFSFLQTESQ
HYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHRSSTPAPPPGRVSSIVAPG
GALREGPLPSGPSLTGCRSDIISLD
NT seq 1878 nt   +upstreamnt  +downstreamnt
atggcggagctgggagaattaaagcacatggtgatgagtttccgggtgtctgagctccag
gtgctcctcggctttgctggccggaacaagagtggacggaaacacgagctcctggccaag
gctctgcatcttctcaagtccagctgtgcccccagtgtccagatgaagatcaaagagctt
taccgtcggcgctttcccaggaagtccctggggccctctgatctctccatgctctctctg
ccccctggcacctctcccgtaggctccccgggccccctagctcccattcccccagccctc
ctggcccctggcactctgctgggccccaagcgcgaggtggacatgcaccccccactcccc
cagcctgtgcaccccgatgtcaccatgaaaccattgcctttctatgaagtctacggggag
ctcattcgacccaccaccctcgcatccacttctagtcatcggtttgaggaagcgcacttt
actttcgccctcaccccccagcaagtgcagcagattctcacgtccagagaggttcttcca
ggagccaaatgtgattataccatacaggtgcagctaaggttctgtctctgtgagaccagc
tgcccccaggaggattatttcccccccaacctctttgtcaaggtcaatgggaaactgtgt
cccctaccgggttaccttcccccgaccaagaatggggcggagcccaagaggcccagccgc
cccatcaacatcacccccctggctagactctcggccaccgttcccaacaccgtcgtggtc
aactggtcatctgagtttggacggaattactccttgtctgtgtacctggtgaggcagttg
actgcagggacccttctacaaaaactcagagcaaaggggatccggaacccagaccactcc
cgggcactgataaaggagaaactgaccgctgaccctgacagtgaggtggctactacgagt
cttcgggtgtccctcatgtgcccgctagggaagatgcggctgactgtcccatgtcgtgcc
ctcacctgtgcccacctgcagagcttcgatgctgccctttacctacagatgaatgagaag
aagccgacgtggacgtgtcctgtgtgtgacaagaaggctccctacgaatctcttattatt
gatggtttattcatggagattcttaattcctgttcggactgtgatgagatccagtttatg
gaagatggatcctggtgcccaatgaaacccaaaaaggaggcatctgaggtttgccccccg
ccagggtatgggctggatggcctccagtatagcccagtccaagagggaaatccatcagag
agtaagaagaaggttgaagttattgacttgacaatagaaagctcatccgatgaggaggat
ctgcccccaaccaagaagcactgtcctgtcacctcagctgccatccctgccctgcctgga
agcaaaggagtcctgacttctagtcaccagccatcctcggtgctgcggagccctgcaatg
ggcacgctgggcagtgacttcctgtccagtctcccactacacgagtacccacctgccttc
cccctggggcccgacatccaaggtttagatttattttcttttcttcagactgagagtcag
cactatggtccttccgtcatcacctcgctagatgaacaggacgcccttggccacttcttc
cagtaccgggggaccccttcccactttctgggccccctggcccccacgttggggagctca
caccgcagctccactccagcaccccctcctggccgcgtcagcagcattgtggctcctgga
ggggccttgagggagggacccctgccttctggtccttccttgactggctgtcggtcagac
atcatttccctggactga

KEGG   Heterocephalus glaber (naked mole rat): 101708989
Entry
101708989         CDS       T02812                                 

Gene name
Pias4
Definition
(RefSeq) protein inhibitor of activated STAT 4
  KO
K16065  E3 SUMO-protein ligase PIAS4 [EC:2.3.2.27]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04064  NF-kappa B signaling pathway
hgl04120  Ubiquitin mediated proteolysis
hgl04630  JAK-STAT signaling pathway
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101708989 (Pias4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101708989 (Pias4)
   04064 NF-kappa B signaling pathway
    101708989 (Pias4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101708989 (Pias4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hgl04121]
    101708989 (Pias4)
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101708989 (Pias4)
Ubiquitin system [BR:hgl04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   101708989 (Pias4)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse Sporozoite_P67 SAP
Other DBs
NCBI-GeneID: 101708989
NCBI-ProteinID: XP_004865832
LinkDB
Position
Un
AA seq 553 aa
MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKE
LYETRYAKKGAEPGPQPHRPLDPLTVHSAYERASAVPRTPLSGPNIDYPVLYGKYLNGLG
RLPAKTLKPEVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSR
ELQPGVKAVQVVLRICYSDTSCPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPC
RPINLTHLMYLSSATNRITVTWGNYGKSYSAALYLVRQLTSAELLQRLETIGVKHPELCK
ALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKK
PTWMCPVCDKPAPYDQLIIDGLAAAPQAAFPPARSSSDSSRLPDPGQVAAAFSGPGYPGP
RLLSKILSECEDADEIEFLADGSWCPIRAEKERSCSPQGPILVLGTSDTNGLVPTPNVNG
SGGMALGSTGVGVGLVGSMENGKLGADVVDLTLDSSSSSEEEEEEDEEEEEEDEEGPRPK
RRCPLPKGLVPAC
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggcggcggagctggtggaggccaaaaacatggtgatgagcttccgggtctccgacctg
cagatgctgctgggattcgtgggccgcagcaagagcgggctgaagcatgagctggtcacc
agggcactgcagctggtgcagttcgactgcagccccgagctctttaagaagatcaaggag
ctctatgagactcgctatgcgaagaagggtgccgagcccggcccgcagccacaccggccc
ctggaccccctcaccgtgcactcggcttatgagcgggccagcgctgtgcccaggactccc
ctgtcaggccccaatattgactaccccgtgctctacgggaagtacctgaacggactggga
cgtttgcctgccaagacactcaaacccgaggtccgcctagtgaagctgcccttcttcaac
atgctggacgagctgctgaagcccacggagttagtcccacagaataatgagaagctgcag
gagagtccctgtatcttcgcgctgacgcccaggcaggtggagctgatccggaactccaga
gagctgcagccgggagtcaaggccgtgcaggttgtgctaagaatctgttactcagacacc
agctgtcctcaggaggaccagtacccgcccaacatcgccgtcaaggtcaaccacagctac
tgctcagtcccgggctactacccttccaacaagcccggagtggagcccaagaggccctgc
cgccccatcaacctcacccacctcatgtacctgtcctcggccactaaccgaatcaccgtc
acctgggggaactatggcaagagctactcagcagcgctgtacctggtgagacagctgacc
tccgctgagctgttgcagaggctggaaaccatcggtgtgaagcacccggagctgtgcaaa
gcgctagtcaaggagaagctgcgtctggatcctgacagcgagattgccaccactggtgtg
cgggtctctctcatctgcccgctggtgaagatgcggctctcggtgccctgccgtgcggag
acctgcgcacacctgcagtgcttcgatgctgtgttctacctgcagatgaacgagaagaag
cctacctggatgtgcccggtgtgtgacaaaccggccccctacgaccagctcatcattgac
ggcctggcagctgcgccccaagctgccttccccccagccaggagcagctcggacagctcc
aggctgcctgatccaggccaggtggctgcagccttctctggccctggctacccagggccc
aggctcctgtccaagatcctgagtgagtgcgaggacgccgatgagatcgagttcctggct
gatgggtcgtggtgccccatccgtgctgagaaagagcggagctgcagcccccagggcccc
atcctggtgcttggcacctcagacaccaatgggctggtgcccacccccaacgtcaacggc
agtggtggcatggcgctgggcagcacaggtgttggggtgggcctggtgggcagcatggag
aatgggaagctgggtgccgacgtggtggacctcacgctggacagctcatcatcgtcagag
gaggaggaagaggaggatgaggaagaggaggaggaggacgaagaaggcccccggcccaag
cgccgctgccccttgcccaagggcctggtgccggcctgctga

KEGG   Heterocephalus glaber (naked mole rat): 101709056
Entry
101709056         CDS       T02812                                 

Gene name
Pias1
Definition
(RefSeq) protein inhibitor of activated STAT 1
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04120  Ubiquitin mediated proteolysis
hgl04630  JAK-STAT signaling pathway
hgl05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101709056 (Pias1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101709056 (Pias1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    101709056 (Pias1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hgl04121]
    101709056 (Pias1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hgl04812]
    101709056 (Pias1)
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     101709056 (Pias1)
Ubiquitin system [BR:hgl04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   101709056 (Pias1)
Cytoskeleton proteins [BR:hgl04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    101709056 (Pias1)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 101709056
NCBI-ProteinID: NP_001290231
UniProt: A0A0A7HV84
LinkDB
Position
Un
AA seq 651 aa
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
YRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHEL
ELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQ
ISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRTYSMAVYLVKQLSSTVLLQRLRAK
GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDAT
LYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGSWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHNQSSSKNKKVEVIDLTIDSSSDEEEEEPSAKRT
CPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDL
QGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTS
LPATNGSSSGSNSSLVSSNSLRESHSHTVASRSSTDAASVFGIIPDIISLD
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggcggacagtgcggaactaaagcaaatggttatgagccttagagtttctgaactccaa
gtattgttgggctacgctgggagaaacaagcacggacgcaaacacgaacttctcacaaaa
gccctgcatttactcaaggctggctgtagtcctgctgtacaaatgaaaattaaagaactc
tataggcgacggttcccccagaaaatcatgacgcctgcggacttgtctatccccaatgta
cattcaagtcctatgccagcaactttgtctccatctaccattccacagctcacttatgat
ggtcaccctgcatcttcaccattactccccgtttctcttctgggacctaaacatgaactg
gaactcccacatcttacatcagctcttcacccagtccatccggatataaaacttcaaaaa
ctaccattttatgacttactggatgaactgataaagcccaccagtctagcatcagacaac
agtcagcgctttcgagaaacctgttttgcatttgccttgaccccacaacaagtgcagcag
atcagtagctccatggatatttccgggaccaaatgtgacttcacagtgcaggtccagtta
aggttttgtttatctgaaaccagttgtccacaagaagatcacttcccacccaatctttgt
gtgaaagtgaatactaaaccttgcagccttccaggttaccttccacctactaaaaatggt
gtggaaccaaagcgacccagcagaccaattaatatcacctcacttgtccgattgtccaca
acagtaccaaacaccattgttgtttcatggactgcggaaattggaagaacctattccatg
gcagtatatcttgtaaaacagttgtcctcaacagttcttcttcagaggttacgagcaaag
ggaataaggaatccggatcattctagagctttaattaaagagaaactgactgctgatcca
gacagtgaaatagctacaaccagcctaagggtttctctactttgtccccttggtaaaatg
cggctgacaattccatgccgagccctcacatgttctcatctgcagtgttttgatgcaact
ctttatattcagatgaatgagaaaaaaccaacctgggtctgtcctgtctgtgataagaag
gctccatatgaacaccttattattgatggcttgtttatggaaatcctaaagtactgtaca
gactgtgatgaaatacagtttaaggaagatggctcttgggcaccaatgcgatcaaaaaag
gaagtacaggaagtttctgcctcttacaatggagttgatggatgcttgagttccactttg
gagcatcaggtggcttctcacaaccagtcctccagtaaaaacaagaaagtcgaggttatt
gacctaaccatagacagctcatctgatgaagaggaggaagagccatctgccaagagaacc
tgtccttccctttctcccacctcaccactaaacaataaaggcattttaagtcttccacac
caagcatctccagtatcccgcaccccaagccttcctgctgtagacacgagctacatcaac
acctctctcatccaagactacaggcatcctttccacatgacacccatgccttatgactta
caaggattagatttctttccattcttgtcaggagacaatcagcattacaacacctccctc
ctcgctgccgcagccgccgcagtctccgatgaccaggacctgctgcactcatcgcgcttt
tttccatatacctcctcccagatgttcctcgaccagctgagtgcaggaggcagcacgtcc
ctgccagccaccaatgggagcagcagtggcagcaacagcagccttgtgtcttccaacagc
ctgagggagagccacagccacacagtggccagcaggagcagcacagacgcggcatccgtc
ttcggcatcataccggacattatctccctggactga

KEGG   Heterocephalus glaber (naked mole rat): 101709303
Entry
101709303         CDS       T02812                                 

Gene name
Pias2
Definition
(RefSeq) protein inhibitor of activated STAT 2
  KO
K16063  E3 SUMO-protein ligase PIAS2 [EC:2.3.2.-]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04120  Ubiquitin mediated proteolysis
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101709303 (Pias2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101709303 (Pias2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hgl04121]
    101709303 (Pias2)
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     101709303 (Pias2)
Ubiquitin system [BR:hgl04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   101709303 (Pias2)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse PHD
Other DBs
NCBI-GeneID: 101709303
NCBI-ProteinID: XP_004855153
UniProt: A0A0P6J1G7
LinkDB
Position
Un
AA seq 620 aa
MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIREL
YRRRYPRTLEGLSDLSAIKSSVFSLDSSSSPVEPDLAVAGIHSLPSTSVTSHSPSSPVGS
VLLQDTKPTFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFI
FALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFP
LPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLT
SAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLTCPLGKMRLTIPCRAV
TCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQE
DGSWCPMRPKKEAMKVSSQPCTKIESSGVLSKPCSVTVAGEVSKKKVDVIDLTIESSSDE
EEDPPAKRKCIFMSETQSSPTKGVLMYQPSIRVPSVTSVDPAAIPPSLTDYSVPFHHTPI
SSMSSDLPGLDFLSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSR
SETGVITSSGSSIPDIISLD
NT seq 1863 nt   +upstreamnt  +downstreamnt
atggcggatttcgaagagttgaggaatatggtttctagttttagagtttctgaactacaa
gtgttactaggctttgctggacggaataaaagtggacgcaagcatgacctcctgatgagg
gccctgcatttattgaagagtggctgcagccctgcggttcagattaaaatccgagaattg
tatagacgccgatatccacggactcttgaagggctttctgatttatctgcaatcaaatca
tcagttttcagtttggatagtagctcatcacctgtagaacctgacctggctgtggctgga
atccactcgttgccctccacttcagttacatctcactcaccgtcctctcctgttggttct
gtgctacttcaagatactaagcccacttttgagatgcagcaaccatctcctccaattcct
cctgtccatcctgatgtgcagttaaaaaacctgcccttttatgatgtccttgatgttctc
atcaagcccacaagtttagttcaaagcagtattcaacgatttcaagagaagttttttatt
tttgctttgacacctcaacaggttagagagatatgcatatcaagggactttttgccaggt
ggtcggagagattatacagttcaagttcagctaagactttgcctggcagagacaagttgt
cctcaagaagataactatcccaatagtctctgtataaaagtaaatgggaaactatttcct
ttgcctggctatgcaccaccaccgaaaaatgggattgagcagaagcgccctggacgcccc
ttgaatattacatctttagtgaggttgtcttcagctgtgccaaaccagatttctatttct
tgggcatctgaaattggaaagaattattctatgtctgtatatcttgtacgacaactgaca
tcagccatgttattacagagattaaaaatgaaaggtattagaaaccccgatcattccaga
gcactaattaaagaaaaacttactgcagatcctgatagtgaaattgctacaactagtctc
cgggtgtccttgacgtgccctctagggaaaatgaggctaacaatcccatgccgtgcagtg
acatgtacacatctgcagtgtttcgatgctgccctttatctacaaatgaatgagaagaag
cccacctggatttgtcctgtctgtgacaaaaaagctgcctacgaaagtctaatattagat
gggctttttatggaaattctcaatgactgttctgatgtggatgagatcaaattccaagaa
gatggttcttggtgtccgatgagaccgaagaaagaagctatgaaagtatccagccaacca
tgtacaaaaatagaaagttcaggtgtcctcagtaagccttgttcagttactgtagccggt
gaggtaagcaagaagaaagtggatgttatcgacctaacaatagaaagctcttctgatgaa
gaggaagacccccctgccaaaaggaaatgcatctttatgtcagaaacacaaagcagccca
accaaaggggttctcatgtatcagccatctataagggtgcctagtgtgacttcggttgat
cctgctgctattccgccttcattaacagactactcagtaccattccaccacaccccaata
tcaagcatgtcatcagatttgccaggtttggattttctttcccttattccagttgatccc
cagtactgtcctcctatgtttttggatagtctcacctcacccttaacagcaagcagtacg
tctgtcaccaccaccagcccccatgaaagcagtactcatgttagttcatccagcagcagg
agtgagacaggggtcataaccagcagtggaagtagcattcctgacatcatctcattggac
taa

DBGET integrated database retrieval system