KEGG   Heterocephalus glaber (naked mole rat): 101700047
Entry
101700047         CDS       T02812                                 

Gene name
Ralgds
Definition
(RefSeq) ral guanine nucleotide dissociation stimulator
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl05200  Pathways in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101700047 (Ralgds)
   04015 Rap1 signaling pathway
    101700047 (Ralgds)
   04072 Phospholipase D signaling pathway
    101700047 (Ralgds)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101700047 (Ralgds)
   05231 Choline metabolism in cancer
    101700047 (Ralgds)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101700047 (Ralgds)
   05212 Pancreatic cancer
    101700047 (Ralgds)
SSDB
Motif
Pfam: RasGEF RasGEF_N RA
Other DBs
NCBI-GeneID: 101700047
NCBI-ProteinID: XP_004849075
LinkDB
Position
Un
AA seq 910 aa
MVQRMWAEAAGPSGTAEPLFPGSRRSRSVWDAVRLEVGVPARGPVVLHSFTQLDPDLPRL
ESSTQEIGEELINGVIYSISLRKVQLQHGASKGQRWLGCENESALNLYETCKVRTVKAGT
LEKLVEHLVPAFQGSDLSYVTIFLCTYRAFTTTQQVLDLLFKRYGRCDVLTASSRYGCIL
PYSSEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLQRR
AHLLLAQLENLEPSEAAPEALAPAPVLALKPAVELEPAPVPVLTSTPIAAPVSGPQLEPA
LASELEAAPAPALEREPTPEPEPEPESEPEPEPELELEPALSRTPELQRALGPRLPTEPP
WLPPVTSENGLAQEQPHILTFPPDLVAEQFTLMDSELFKKVVPYHCLGSIWSQRDKKGKE
HLAPTIRATVAQFNNVANCVITTCLGDRSMKAPDRARVVEHWIEVARECRALKNFSSLYA
ILSALQSNAIHRLKKTWEDVSRDSIRIFQKLSEIFSDENNYSLSRELLIKEGTSKFATLE
MNPRRAHRRPKEAGVIQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFEVIAQ
IKLLQSACNNYSIAPKEHFGAWFRALERLGEAESYSLSCELEPPSESASNTLKSRKSTAI
VKRWSDRQVPSTELSTSGSSHSKSCDQLRCGPYLSSGDIADALSVHSAGSSSSDVEEINM
SFVPESPDGQEKKFWESASQSSPETSGISSASSSTSSSSASTTPVATTRTHKRSVSGVCS
YSSSLPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPTVIRKAMDKHNLDEDEPE
DYELVQVISDDRKLKIPENANVFYAMNSTANYDFILKRRTFSKGTKVKHGASSTLPRMKQ
KGLKIAKGIF
NT seq 2733 nt   +upstreamnt  +downstreamnt
atggtgcagcgcatgtgggccgaagcggccgggccttcgggcaccgccgagccgctgttc
ccgggctcccggcggagccgcagcgtgtgggacgctgtgcgactggaggtgggagtccca
gcccggggccccgtggtgctacacagcttcacgcagctcgaccccgacctgcctcgtctg
gagagctccacacaggagatcggcgaggagctgatcaacggggtcatctactccatctcc
ctgcgcaaggtgcagctgcagcacggagccagcaagggccagcgctggcttgggtgtgag
aatgagtcggccctgaacctctatgaaacctgtaaggtgcggactgtgaaggcaggcacg
ctggagaagctggtggagcacctggtgcccgccttccagggcagcgacctctcctacgtc
accatcttcttgtgcacctacagagccttcaccaccacccagcaggtgctggacctgctc
ttcaaaaggtatggtagatgtgacgtcctcacggcctcctctagatatggctgcatcctc
ccctactccagcgaggacggcgggcctcaggaccaactcaaaaatgccatctcctccatc
ctgggcacctggctggaccagtattcagaggacttctgccagcctccagacttcccctgc
ctcaagcagctggtggcttatgtgcagctcaacatgcctggctcagacctgcagcgccgt
gcgcatcttctgctggctcagctggagaacttggagcccagcgaggccgcacctgaggct
ctggcaccagctccagtgctagccctgaaaccagccgtggagctggagccggctccagtc
ccagttctgacgtccactccaatagcagcaccagtatcgggtccacagctggagccagca
ttggcttctgagctcgaggcagctcctgcacctgctctggagcgagagcccacgccggag
ccggagccagagccggagtcggagccggaaccagagccggagctggagctggagcctgct
ctgtcacgaactccagagctgcagcgggccctgggccccaggctgcccaccgagccaccc
tggcttccacccgtgacctcagagaacggactggcccaggagcagcctcacatcctgacg
ttccctcctgacctggtggcggagcagttcacgctgatggattcggagctgttcaagaag
gtggtgccctaccactgcctgggctccatctggtcccagcgggacaagaagggcaaggag
cacctggcacccaccatccgtgccaccgttgcccagttcaacaacgtggccaactgtgtc
atcactacctgcctgggggaccggagcatgaaggccccggacagggcccgggtggtggag
cactggatcgaggtggccagggagtgccgcgccctgaagaacttctcctccctgtacgcc
atcctctctgctctgcagagcaatgccatccaccgcctgaagaagacatgggaagacgtc
tccagggacagcatccggatattccagaagctctctgagattttctctgatgagaacaat
tactcactgagtagagagctgctcatcaaggagggcacctccaagtttgccaccctggag
atgaaccccaggagagctcacaggcggccaaaggaggcgggcgtcatccagggcactgtc
ccctacctgggcactttcctcaccgacctggtgatgctggacaccgccatgaaagactat
ctctatgggagactgatcaacttcgagaagcggaggaaggaattcgaagtgatcgcgcag
atcaagctactgcagtcggcctgcaacaattacagcatcgcgcccaaggagcactttggg
gcgtggttccgggccctggagcggctcggagaggctgagagctacagcctatcatgcgag
ctggagcccccgtctgagtcggccagcaacaccctcaagtccaggaagagcacagccatt
gtgaagcgctggagcgaccgccaggtgcccagcaccgagctcagtaccagcggcagctcc
cactccaagtcctgtgaccagctcaggtgcggcccctacctcagcagcggggacatcgcc
gatgcgctcagtgtgcactcagccggctcctccagctctgacgtggaggagatcaacatg
agctttgtcccagagtccccggacggccaggaaaagaagttctgggagtcggcctcccag
tcctccccggaaacctccggcatcagctcggcctccagcagcacgtcctcgtcctcagcc
tccaccacgcccgtggccaccacgcgcacccacaagcgctctgtctcaggggtctgcagc
tacagctcctcactgccgctctacaaccagcaggtgggcgactgctgcatcatccgcgtc
agcctggacgtggacaacggcaacatgtacaagagcatcctggtgacaagccaggataag
gctcccacggtcatccgcaaggccatggacaaacacaacctggacgaggatgagccggag
gactatgagctggtgcaagtcatctcagacgatcgcaagctgaagatccccgaaaacgcc
aacgtgttctacgccatgaactctactgccaactacgacttcatcctgaagaggcggacc
ttctccaagggcacaaaggtcaagcatggagccagctccaccctccctcgcatgaagcag
aaaggactcaagattgccaagggcatcttctaa

DBGET integrated database retrieval system