KEGG   Heterocephalus glaber (naked mole rat): 101700245
Entry
101700245         CDS       T02812                                 

Gene name
Arhgef6
Definition
(RefSeq) Rac/Cdc42 guanine nucleotide exchange factor 6
  KO
K05729  Rho guanine nucleotide exchange factor 6
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04810  Regulation of actin cytoskeleton
hgl05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101700245 (Arhgef6)
 09160 Human Diseases
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101700245 (Arhgef6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101700245 (Arhgef6)
Membrane trafficking [BR:hgl04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    101700245 (Arhgef6)
SSDB
Motif
Pfam: RhoGEF67_u2 betaPIX_CC RhoGEF CH SH3_2 RhoGEF67_u1 SH3_9 SH3_1 PH CAMSAP_CH ZapB DUF2204
Other DBs
NCBI-GeneID: 101700245
NCBI-ProteinID: XP_012934140
LinkDB
Position
Un
AA seq 772 aa
MNPEEQIVTWLISLGVLDSPKKTICDPEEFLKSSLKNGVVLCKLINRLIPGSVEKYCLEP
QTEANCVSNISEFLKGCVPLQVEVFDPDDLYSGVNFSKVLTTLLAVNKATEDQLSERPCG
RSSSLSTANSSQTSPQRAVSSTAPGLQKQAKAVEMTENGSHQLIVKARFNFKQTNEDELS
VCKGDIIYVTRIEEGGWWEGTLNGRTGWFPSNYVREIKPSERPLSPKGVKGFETAPLTKN
YYTVVLQNILDTEREYAKELQSLLVTYLRPLQSNNNLSTVEFTSLLGNFEEICTFQHTLC
QTLEECSKFPENQHKVGGCLLNLMPHFKSMYLAYCANHPSAVNVLTQRSDDLEQFMENQG
ASSPGILILTTSLSKPFMRLEKYVTLLQELERHMEDTHPDHQDILKAIIAFKTLMGQCQD
LRKRKQLELQILSEPIQAWEGEDIKTLGNVIFMSQVMVQYGTCEEKEERYLLLFSNVLIM
LSASPRMSGFIYQGKIPIAGMVVTRLDEIEGNDCTFEITGNIVERVVVHCNNNQDFQEWL
EQLSRLTRGPASCSSLSKTSSSSCSAHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPL
RPSAALGYKERMSYILKESSKSPKTMKKFLHKRKTERKPSEEEYVIRKSTAALEEDAQIL
KVIEAYCTSANFQQGARKDSVPQVLLPEEEKLIIEETRSNGQTIIEEKSLVDTVYALKDE
VKELKQENKRMKQCLEEELKSRRDLEKLVRRLLKQTDECIRAESSSKTSILP
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgaatccagaagagcagatcgtgacgtggcttatatctctcggcgttttagattccccc
aaaaagaccatctgcgatcctgaggagtttttgaagtcctcgctaaaaaatggggtagtg
ctatgcaaattgatcaacagacttattcctggctccgtggaaaagtattgtctggagccc
caaaccgaagccaactgcgtcagcaacatcagtgaattcctgaaaggatgtgtgcccctt
caagtggaggtctttgatcccgatgacctttattcaggggtcaatttctccaaggttctg
actactcttttagctgtcaacaaagcaacagaagatcagctatcagaaagaccatgtgga
cgttcctcttctcttagtactgctaatagttctcagacaagcccacagagagcagtttct
agcacagctccagggctgcaaaagcaggcaaaggcagtggagatgacggaaaatggaagt
catcagttgatagtgaaggcaagattcaactttaagcagactaacgaagatgaactatcc
gtctgtaaaggggacatcatttatgtcactcgcattgaagaaggaggctggtgggaaggc
acactaaatgggagaacaggctggttccctagtaattatgtccgagaaatcaaacccagt
gagagacctctctcccctaagggtgtcaaaggatttgaaactgctccacttaccaagaat
tattataccgtggtattacagaacatcttggatactgaaagagagtatgctaaagaactt
cagtctctccttgtaacttacttaagaccgctgcaatccaataacaacctgagtactgtg
gagtttacatctttactgggaaacttcgaagaaatatgtacatttcaacacacactctgc
caaactttggaagaatgctcaaagtttccagaaaaccaacacaaagtaggaggttgtcta
ctgaatctcatgcctcattttaaatcgatgtatctggcttactgtgcaaatcacccttca
gctgtaaatgtgctcacccagcgcagtgatgatctggaacagtttatggaaaatcaaggt
gcatccagcccaggtatcctcattttaaccaccagtctcagcaaaccattcatgcgactg
gaaaagtatgttactctcttgcaagaactggaacggcatatggaggatactcatccagat
catcaagatattctgaaagcaatcatagcattcaaaactctcatgggtcagtgccaagat
ctgagaaagagaaaacagctggagttgcagatactttccgaacctattcaggcatgggaa
ggggaggatattaaaaccttgggaaatgtgatctttatgtcacaagtaatggtgcagtat
ggaacatgtgaggaaaaagaggaacgataccttctgctgttttcaaatgtcttgataatg
ttatctgcaagccctcggatgagtggctttatctatcagggaaaaataccaatagcagga
atggtggtgactagattagatgaaattgaagggaacgactgtacatttgaaatcacaggt
aacatagtagagagagttgtggtccattgcaataacaaccaggacttccaggaatggttg
gagcagctgagcagactgaccaggggacctgcgtcttgcagttcattatccaaaacatca
tcatcatcgtgtagtgctcattcctcttttagctctaccggacagccccgaggacccttg
gagcctcctcaaattataaaaccgtggagtttaagttgtctacgacctgcacctccactt
agaccatcagcagcactaggttataaagagaggatgtcttatatcttaaaggagtccagt
aaaagccccaaaacaatgaagaagtttcttcacaaaagaaagactgagagaaaaccatca
gaagaggaatacgtgatcaggaaaagtacggctgctctggaagaggatgctcaaattctt
aaggtgattgaagcctactgcaccagcgccaattttcaacaaggtgctcggaaagattct
gtcccacaagtcttactccccgaggaagagaaactcatcattgaagaaactagaagcaac
ggccagactatcatcgaggaaaagagccttgtcgatactgtttatgccttgaaggatgaa
gtcaaggaactgaagcaggagaataaaagaatgaagcaatgcttggaagaagaattgaag
tcaagaagggacctggaaaagctggtccgaaggcttttgaagcaaacagatgagtgcatt
cgagctgaatccagtagcaagacctcgattcttccataa

DBGET integrated database retrieval system