KEGG   Heterocephalus glaber (naked mole rat): 101700438
Entry
101700438         CDS       T02812                                 

Gene name
Pld1
Definition
(RefSeq) phospholipase D1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00564  Glycerophospholipid metabolism
hgl00565  Ether lipid metabolism
hgl01100  Metabolic pathways
hgl04014  Ras signaling pathway
hgl04024  cAMP signaling pathway
hgl04071  Sphingolipid signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04144  Endocytosis
hgl04666  Fc gamma R-mediated phagocytosis
hgl04724  Glutamatergic synapse
hgl04912  GnRH signaling pathway
hgl04928  Parathyroid hormone synthesis, secretion and action
hgl05200  Pathways in cancer
hgl05212  Pancreatic cancer
hgl05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101700438 (Pld1)
   00565 Ether lipid metabolism
    101700438 (Pld1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101700438 (Pld1)
   04072 Phospholipase D signaling pathway
    101700438 (Pld1)
   04071 Sphingolipid signaling pathway
    101700438 (Pld1)
   04024 cAMP signaling pathway
    101700438 (Pld1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101700438 (Pld1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101700438 (Pld1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101700438 (Pld1)
   04928 Parathyroid hormone synthesis, secretion and action
    101700438 (Pld1)
  09156 Nervous system
   04724 Glutamatergic synapse
    101700438 (Pld1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101700438 (Pld1)
   05231 Choline metabolism in cancer
    101700438 (Pld1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101700438 (Pld1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101700438 (Pld1)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     101700438 (Pld1)
Membrane trafficking [BR:hgl04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101700438 (Pld1)
 Endosome - Golgi transport
  Others
   Others
    101700438 (Pld1)
SSDB
Motif
Pfam: PLDc_2 PLDc PX PH DUF3785
Other DBs
NCBI-GeneID: 101700438
NCBI-ProteinID: XP_004834654
LinkDB
Position
Un
AA seq 1042 aa
MSKVNMSLKNESRVNTSALQKIAADMSNLIENLDTRELHFEGEEVEYDVFPGDPKAQEVC
IPFSAIYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTSRVPSINLYTIELTHGEFKWQ
VKRKFKHFQEFHRELLKYKAFIRIPIPTKRHTFRRQNVKGEAPREMPSLPSSHENRIQEE
QFYGRRKQLEDYLTKILKMPMYKNYHATTEFLDISQLSFIRDLGPKGLEGMIMKRSGGHR
IPGLNCCGQGRACYRWSKRWLVVKDSFLLYMKPDSGAIAFVLLVDKEFRIKVGKKDTETK
YGLRIDNLSRTLILKCNSYRHARWWGGAIEDFIQKYGANFLKDHRFGSYAAIQDSTLAKW
YVNAKGYFEDVANAMEEAKEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVQ
IFIMLYKEVELALGINSEYSKRTLVRLHPNIKVMRHPDHVSSSVYLWAHHEKLVIIDQSV
AFVGGIDLAYGRWDDNEHRLTDVGSVKRVISGPSLGSLTAAVTESMESLSLKNKHESNKN
IPSPKSPDDTDSKLKGLGKPRKLSKLNLYRQLHWHHLHSMDSLSSLESSSNTGSIRSLQT
GVGELHGETRFWHGKDYCNFVFKDWVQLDKPFADFIDRYSTPRMPWHDIASVVHGKAARD
VARHFIQRWNFTKIMKPKYRSLSYPFLLPKSQITAHELRYQVPGAVHASVQLLRSAADWS
AGIKYHEESIHSAYTYVIENSKHYIYIENQFFISCADDKVVFNKVGDAITQRILKAHREG
KRYRVYVVIPLLPGFEGDISTGGGNALQAIMHFNYRTMCRGENSILEQLKPKLGNQWINY
ISFCGLRTHAELEGNLVTELIYVHSKLLIADDNTVIIGSANINDRSMLGKRDSEMAVIVQ
DTEMIPSVMDGQEYQAGLFAQGLRLQCFRIVLGYLSDPSEDLQDPVSDKFFKEVWVSTAA
RNATIYDKVFRCLPNDEVHNLMQLRDFINKPILAKEDPIRAEEELKKIRGFLVQFPFYFL
SEESLLPSVGTKEAIVPTEVWT
NT seq 3129 nt   +upstreamnt  +downstreamnt
atgtccaaagttaacatgtcattgaaaaatgagtcaagagtaaatacctctgcactgcag
aaaattgctgccgacatgagcaatttgatagaaaatctggacacacgagagctccatttt
gaaggagaggaggtggaatatgatgtgtttcctggtgaccccaaggctcaagaagtgtgt
atccctttctctgctatttataacactcaaggatttaaggagcctaatatacagacgtat
ctctccggctgtccaataaaagcacaagttctggaagtggagcgtttcacatctacatca
agggtgccaagtatcaatctatacactattgaattaacacatggggaatttaaatggcaa
gttaagaggaaattcaagcactttcaagaatttcacagagaactgctcaagtacaaagcc
tttatccgcatccccattcccactaaaaggcacacatttagaagacaaaatgtcaaaggg
gaagcgcctcgagaaatgcccagtttgcccagttcacatgaaaataggattcaagaagaa
cagttctatggaagaaggaaacaactggaagattacctgacaaagatactaaaaatgccc
atgtataaaaactatcatgccacaacagaattccttgatataagccagttatctttcatc
cgtgatttgggaccaaagggcctagaaggcatgatcatgaaaagatccgggggacacaga
ataccaggtttgaattgctgtggtcaggggagagcctgctacagatggtcaaaaaggtgg
ttagtagtgaaagattcctttttattatatatgaaaccagacagtggtgctattgccttc
gttctgctggtagataaagaatttagaattaaggtggggaagaaagacacagaaacgaaa
tatggacttcgaattgataatctttcaaggacacttattttaaaatgcaacagctacaga
catgctcggtggtggggaggagctatagaagatttcatccagaaatatggcgccaacttt
ctcaaggaccatcgatttgggtcatatgctgctatccaggacagcactttagctaaatgg
tacgttaatgccaaaggatattttgaagatgtggcaaatgcaatggaagaggcaaaagaa
gagatttttatcacagattggtggttgagtccagaaattttccttaaacgccccgtggtt
gaaggaaatcgttggagattggactgcattcttaaacgaaaagcacaacaaggggtgcag
atcttcataatgctctacaaagaggtggagctcgccctgggaatcaacagtgaatatagc
aagcggactttagtgcggctgcaccctaacatcaaggtgatgaggcacccagatcatgtg
tcgtccagtgtttatttatgggctcatcatgagaaacttgtcatcatcgatcaatcagtg
gcctttgtgggtgggattgacctggcctatggaaggtgggatgacaatgaacacagactc
acagatgtgggaagcgtgaagcgggtcatttcaggaccatctctgggttctctcacggct
gcagtcacagagtctatggaatccttaagcctcaaaaataaacatgaatctaataaaaat
attcccagcccgaagagtcctgatgatacagactcaaaactgaaaggcttaggaaagcca
cgaaagttgtccaaacttaacctctaccggcagctccactggcaccacctgcacagtatg
gacagcctcagcagcctggaaagcagctccaatactggctccatccgcagcttacagact
ggcgtgggagagctgcatggggagaccagattctggcatgggaaggattactgcaacttt
gtcttcaaagactgggttcagctggataaaccttttgctgatttcattgacaggtactct
accccccggatgccctggcacgacattgcctctgtagtccacgggaaggcagctcgagat
gtggcgcgtcacttcatccagcgatggaacttcacaaagattatgaaaccaaaatatcgg
tccctttcttatccttttctgcttccaaagtctcaaatcacagcccatgagctgagatac
caagtgcctggggctgtccacgctagtgtacagttgctccgttctgctgctgattggtct
gctggtataaagtaccatgaggaatctatccacagtgcttacacctatgtgatagagaac
agcaagcactatatttatattgaaaaccaattttttataagctgtgctgatgacaaagtt
gtgttcaataaggtgggtgatgctattactcagaggatcctgaaagctcacagggaagga
aagcgataccgggtctatgttgtgataccacttctgccgggattcgaaggagacatttca
actggaggaggaaatgctctgcaggccataatgcacttcaactacagaaccatgtgcagg
ggagaaaattccatcctcgaacagttaaaaccaaaacttggtaatcagtggataaattac
atttcattctgtggtcttagaacacatgcagagcttgaaggaaacctagtcactgaactt
atctatgtccacagcaagttgttaattgctgatgataacactgttattattggctctgcc
aacataaacgaccgaagcatgctggggaagcgtgacagtgaaatggctgtcattgtacag
gacacagagatgatcccatcagtaatggatggacaagagtaccaggctggcctgtttgcc
caaggactgcggctacagtgcttcaggattgtccttggctacctttctgacccaagtgag
gaccttcaggatccagtgagtgacaaatttttcaaggaggtgtgggtttcaacagcagct
cgaaatgctacaatttatgataaggtgttccgatgccttcccaatgatgaagtacacaat
ttaatgcagttgagagacttcataaacaagcccatattagcaaaggaagatcccatcaga
gctgaggaggaactaaaaaagatccgtggattcttggtgcaattccccttttacttcttg
tctgaagaaagcctgctgccttctgttggaaccaaagaagccatagtgcccacagaggtt
tggacttaa

KEGG   Heterocephalus glaber (naked mole rat): 101713528
Entry
101713528         CDS       T02812                                 

Gene name
Pld2
Definition
(RefSeq) phospholipase D2
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00564  Glycerophospholipid metabolism
hgl00565  Ether lipid metabolism
hgl01100  Metabolic pathways
hgl04014  Ras signaling pathway
hgl04024  cAMP signaling pathway
hgl04071  Sphingolipid signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04144  Endocytosis
hgl04666  Fc gamma R-mediated phagocytosis
hgl04724  Glutamatergic synapse
hgl04912  GnRH signaling pathway
hgl04928  Parathyroid hormone synthesis, secretion and action
hgl05200  Pathways in cancer
hgl05212  Pancreatic cancer
hgl05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101713528 (Pld2)
   00565 Ether lipid metabolism
    101713528 (Pld2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101713528 (Pld2)
   04072 Phospholipase D signaling pathway
    101713528 (Pld2)
   04071 Sphingolipid signaling pathway
    101713528 (Pld2)
   04024 cAMP signaling pathway
    101713528 (Pld2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101713528 (Pld2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101713528 (Pld2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101713528 (Pld2)
   04928 Parathyroid hormone synthesis, secretion and action
    101713528 (Pld2)
  09156 Nervous system
   04724 Glutamatergic synapse
    101713528 (Pld2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101713528 (Pld2)
   05231 Choline metabolism in cancer
    101713528 (Pld2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101713528 (Pld2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101713528 (Pld2)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     101713528 (Pld2)
Membrane trafficking [BR:hgl04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101713528 (Pld2)
 Endosome - Golgi transport
  Others
   Others
    101713528 (Pld2)
SSDB
Motif
Pfam: PX PLDc PLDc_2 PH PH_2
Other DBs
NCBI-GeneID: 101713528
NCBI-ProteinID: XP_004857340
LinkDB
Position
Un
AA seq 936 aa
MIATQECPFPYGDYLDSSQLHMEPDEVNTLREGEDPADRMHPFLAIYDLQPLKVHPLVFA
PGVSVIAQVVGTERYTSGSKVGTCTLYSVRLTHGDFTWTTKKKFRHFQELHRDLQRHKVL
MSLLPLARFAVAYSPAQEAADRANREMPSLPRGGPEGSTRHAASKQKYLENYLNHLLTMS
FYRNYHAMTEFLEVSQLSFIPDLGPKGLEGVIRKRSGGHRLPGLTCCGRDQVCYRWSKRW
LVVKDSFLLYMCLETGVISFVQLFDSGFEVQVGKRSTETRYGVRIDTSHRSLILKCSSYR
QARWWGQEITELAQGPGKDFLRLHQHDSYAPPRPGTLARWFVNGAGYFAAVADAILRARE
EIFITDWWLSPEVYLKRPAHSDDWRLDIMLKKAAEEGVRVSVLLFKEVELALGINSGYSK
RTLMLLHPNIKVMRHPDQMTLWAHHEKLLVVDQAVAFLGGLDLAYGRWDDLHYRLTDLGD
SSESGASQTPTPCTDSAATPDLSHNQFFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPR
MPWRDVGVVVHGLAARDLARHFIQRWNFTKTTKAKYKTPMYPYLLPKSTSTANQLPFTIP
GGQCTTVQVLRSVDRWSAGTLENSILNAYLHTIRESKHFLYIENQFFISCSDGRTVLNKV
GDEIVDRILKAHKQGQCFRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSI
LHRLKAAMGTAWRDYMSICGLRTHGELGGHPVSELIYIHSKMLIADDRTVIIGSANINDR
SLLGKRDSELAVLIEDTEMVPSLMDGMEYQAGRFALSLRKHCFSVILGANAWPDLDLQDP
VCDDFFQLWQETAENNANIYEQIFRCLPSNATRSLRTLREYVAVEPLAVVSPPLARSELT
EIQGHLVHFPLKFLEDESLLPSLGSKEGMIPLEVWI
NT seq 2811 nt   +upstreamnt  +downstreamnt
atgattgctacccaggaatgccccttcccctatggggactacctggactccagccagtta
cacatggagccggatgaagtcaacaccctgagggagggagaggacccagctgaccgaatg
catccctttctggccatctatgaccttcagcctctgaaagtgcaccccttggtgtttgcc
cctggggtctctgtcatagcccaggtagtgggaactgaaagatacaccagtggatccaag
gtgggaacctgcactctgtattctgtccgcttgactcatggtgactttacctggacaacc
aagaagaagttccgtcatttccaggagctacatcgggacctccagagacacaaagtcttg
atgagtttgctccctctggctcgctttgctgttgcctattctccagcccaagaggcagcc
gacagagccaacagagagatgccctctctaccccgaggaggacctgagggctccaccaga
catgcagccagcaaacagaaatatctggaaaattatctcaaccacctcctgaccatgtct
ttctaccgaaactaccatgctatgacagaattcctggaagtcagtcagctctcctttatc
ccggacctgggacccaaaggactggagggggtgatccggaagcgctcaggtggccaccgt
cttcctggcctcacctgttgtggtcgagaccaagtctgttaccgctggtccaagaggtgg
ctggtggtgaaagactccttcctgctgtacatgtgtctggagactggtgtcatctctttt
gttcagctctttgactctggctttgaggtgcaggtggggaaacggagcacagagacacgg
tatggggtgcggatcgacacctcccacaggtccctgattctcaagtgcagcagctaccgg
caggcacgatggtggggccaggagatcacagagctggcacagggcccggggaaagacttc
ctacggctgcaccagcatgacagctatgccccaccccggcctgggaccttggcccggtgg
tttgtgaatggggcaggttactttgctgctgtggcagatgccatcctgcgagcccgagag
gagatttttatcacagactggtggctgagtcctgaggtttacctgaagcgcccagcccat
tcggacgactggaggctggacattatgctcaagaaggcagcggaggagggtgttcgtgtg
tctgttctgctgtttaaggaagtggaattggccttgggcatcaacagtggctatagcaag
aggacactgatgctgctacaccccaacataaaggtgatgcgccatccagaccagatgaca
ctgtgggctcatcatgagaagctcctagtggttgaccaagcagtggccttcctggggggg
ctggacctcgcctatggccgctgggatgaccttcactaccgactgaccgaccttggggac
tcatctgaatcaggtgcctcacagactcccaccccatgcacagactctgcagccacccca
gacctctctcacaaccaattcttctggctgggcaaggactacagcaatctcatcactaag
gactgggtgcaattagaccggccttttgaagatttcattgacagggagaccacaccccgg
atgccatggagggatgttggggtggttgtccatggcttagctgcccgtgaccttgcccgg
cacttcatccagcgctggaacttcaccaagaccaccaaggctaagtacaagacacctatg
tacccctatctgctacccaagtccaccagcactgcaaaccagctccctttcacaatccct
ggtgggcagtgcaccactgtgcaggtcttgcggtctgtggaccgctggtcagcggggacg
ctggagaactccatccttaatgcctacctgcacaccatcagggagagcaagcacttcctc
tacattgagaatcagttcttcattagctgctcagatgggcgcacggtcctgaacaaggtg
ggcgatgagattgtggacagaatcctgaaggcccacaagcaggggcagtgtttccgagtc
tatgtgcttctgcccttgctccctggctttgagggtgacatctccacaggtggtggtaac
tctatccaggccattctgcacttcacatacaggaccctgtgtcgaggcgagtattcaatc
ctacatcgcctcaaagcagccatggggacagcatggcgggactacatgtccatctgtggg
cttcgcacacacggagagctgggcgggcacccagtctcagagctcatctatattcacagc
aagatgcttattgcagatgaccggacggtcatcattggttctgcaaacatcaatgaccgg
agcttgctagggaagcgggacagtgagctggctgtgctgatcgaggacacagagatggtg
ccatcccttatggatggaatggagtatcaggcaggcaggtttgccttgagtttgcggaag
cactgtttcagtgtgattcttggggcaaatgcctggccagacctggatctgcaagaccca
gtctgtgatgacttcttccagttgtggcaagaaacagcagagaacaatgccaatatctat
gagcagatcttccgatgcctgccgtccaatgccacgcgttccctgcggactctccgggag
tacgtggctgtggagcccctggctgtggtcagtcctcccttggcccgatctgagctcact
gaaatccagggccacctggttcactttcccctcaagttcctggaggatgaatctttgctg
ccctcactggggagcaaggagggcatgatacccctagaagtatggatatag

DBGET integrated database retrieval system