Heterocephalus glaber (naked mole rat): 101700695 Help Entry 101700695         CDS       T02812                                  Gene name Akt1 Definition (RefSeq) AKT serine/threonine kinase 1   KO K04456   RAC serine/threonine-protein kinase [EC:2.7.11.1] Organism hgl  Heterocephalus glaber (naked mole rat) Pathway hgl01521   EGFR tyrosine kinase inhibitor resistance hgl01522   Endocrine resistance hgl01524   Platinum drug resistance hgl04010   MAPK signaling pathway hgl04012   ErbB signaling pathway hgl04014   Ras signaling pathway hgl04015   Rap1 signaling pathway hgl04022   cGMP-PKG signaling pathway hgl04024   cAMP signaling pathway hgl04062   Chemokine signaling pathway hgl04066   HIF-1 signaling pathway hgl04068   FoxO signaling pathway hgl04071   Sphingolipid signaling pathway hgl04072   Phospholipase D signaling pathway hgl04140   Autophagy - animal hgl04150   mTOR signaling pathway hgl04151   PI3K-Akt signaling pathway hgl04152   AMPK signaling pathway hgl04210   Apoptosis hgl04211   Longevity regulating pathway hgl04213   Longevity regulating pathway - multiple species hgl04218   Cellular senescence hgl04261   Adrenergic signaling in cardiomyocytes hgl04370   VEGF signaling pathway hgl04371   Apelin signaling pathway hgl04380   Osteoclast differentiation hgl04510   Focal adhesion hgl04550   Signaling pathways regulating pluripotency of stem cells hgl04611   Platelet activation hgl04613   Neutrophil extracellular trap formation hgl04620   Toll-like receptor signaling pathway hgl04625   C-type lectin receptor signaling pathway hgl04630   JAK-STAT signaling pathway hgl04660   T cell receptor signaling pathway hgl04662   B cell receptor signaling pathway hgl04664   Fc epsilon RI signaling pathway hgl04666   Fc gamma R-mediated phagocytosis hgl04668   TNF signaling pathway hgl04722   Neurotrophin signaling pathway hgl04725   Cholinergic synapse hgl04728   Dopaminergic synapse hgl04910   Insulin signaling pathway hgl04914   Progesterone-mediated oocyte maturation hgl04915   Estrogen signaling pathway hgl04917   Prolactin signaling pathway hgl04919   Thyroid hormone signaling pathway hgl04920   Adipocytokine signaling pathway hgl04922   Glucagon signaling pathway hgl04923   Regulation of lipolysis in adipocytes hgl04926   Relaxin signaling pathway hgl04929   GnRH secretion hgl04931   Insulin resistance hgl04932   Non-alcoholic fatty liver disease hgl04933   AGE-RAGE signaling pathway in diabetic complications hgl04935   Growth hormone synthesis, secretion and action hgl04973   Carbohydrate digestion and absorption hgl05010   Alzheimer disease hgl05017   Spinocerebellar ataxia hgl05132   Salmonella infection hgl05135   Yersinia infection hgl05142   Chagas disease hgl05145   Toxoplasmosis hgl05152   Tuberculosis hgl05160   Hepatitis C hgl05161   Hepatitis B hgl05162   Measles hgl05163   Human cytomegalovirus infection hgl05164   Influenza A hgl05165   Human papillomavirus infection hgl05166   Human T-cell leukemia virus 1 infection hgl05167   Kaposi sarcoma-associated herpesvirus infection hgl05168   Herpes simplex virus 1 infection hgl05169   Epstein-Barr virus infection hgl05170   Human immunodeficiency virus 1 infection hgl05200   Pathways in cancer hgl05205   Proteoglycans in cancer hgl05210   Colorectal cancer hgl05211   Renal cell carcinoma hgl05212   Pancreatic cancer hgl05213   Endometrial cancer hgl05214   Glioma hgl05215   Prostate cancer hgl05218   Melanoma hgl05220   Chronic myeloid leukemia hgl05221   Acute myeloid leukemia hgl05222   Small cell lung cancer hgl05223   Non-small cell lung cancer hgl05224   Breast cancer hgl05225   Hepatocellular carcinoma hgl05226   Gastric cancer hgl05230   Central carbon metabolism in cancer hgl05231   Choline metabolism in cancer hgl05235   PD-L1 expression and PD-1 checkpoint pathway in cancer hgl05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101700695 (Akt1)    04012 ErbB signaling pathway     101700695 (Akt1)    04014 Ras signaling pathway     101700695 (Akt1)    04015 Rap1 signaling pathway     101700695 (Akt1)    04370 VEGF signaling pathway     101700695 (Akt1)    04371 Apelin signaling pathway     101700695 (Akt1)    04630 JAK-STAT signaling pathway     101700695 (Akt1)    04668 TNF signaling pathway     101700695 (Akt1)    04066 HIF-1 signaling pathway     101700695 (Akt1)    04068 FoxO signaling pathway     101700695 (Akt1)    04072 Phospholipase D signaling pathway     101700695 (Akt1)    04071 Sphingolipid signaling pathway     101700695 (Akt1)    04024 cAMP signaling pathway     101700695 (Akt1)    04022 cGMP-PKG signaling pathway     101700695 (Akt1)    04151 PI3K-Akt signaling pathway     101700695 (Akt1)    04152 AMPK signaling pathway     101700695 (Akt1)    04150 mTOR signaling pathway     101700695 (Akt1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101700695 (Akt1)   09143 Cell growth and death    04210 Apoptosis     101700695 (Akt1)    04218 Cellular senescence     101700695 (Akt1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101700695 (Akt1)    04550 Signaling pathways regulating pluripotency of stem cells     101700695 (Akt1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     101700695 (Akt1)    04613 Neutrophil extracellular trap formation     101700695 (Akt1)    04620 Toll-like receptor signaling pathway     101700695 (Akt1)    04625 C-type lectin receptor signaling pathway     101700695 (Akt1)    04660 T cell receptor signaling pathway     101700695 (Akt1)    04662 B cell receptor signaling pathway     101700695 (Akt1)    04664 Fc epsilon RI signaling pathway     101700695 (Akt1)    04666 Fc gamma R-mediated phagocytosis     101700695 (Akt1)    04062 Chemokine signaling pathway     101700695 (Akt1)   09152 Endocrine system    04910 Insulin signaling pathway     101700695 (Akt1)    04922 Glucagon signaling pathway     101700695 (Akt1)    04923 Regulation of lipolysis in adipocytes     101700695 (Akt1)    04920 Adipocytokine signaling pathway     101700695 (Akt1)    04929 GnRH secretion     101700695 (Akt1)    04915 Estrogen signaling pathway     101700695 (Akt1)    04914 Progesterone-mediated oocyte maturation     101700695 (Akt1)    04917 Prolactin signaling pathway     101700695 (Akt1)    04926 Relaxin signaling pathway     101700695 (Akt1)    04935 Growth hormone synthesis, secretion and action     101700695 (Akt1)    04919 Thyroid hormone signaling pathway     101700695 (Akt1)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     101700695 (Akt1)   09154 Digestive system    04973 Carbohydrate digestion and absorption     101700695 (Akt1)   09156 Nervous system    04725 Cholinergic synapse     101700695 (Akt1)    04728 Dopaminergic synapse     101700695 (Akt1)    04722 Neurotrophin signaling pathway     101700695 (Akt1)   09158 Development and regeneration    04380 Osteoclast differentiation     101700695 (Akt1)   09149 Aging    04211 Longevity regulating pathway     101700695 (Akt1)    04213 Longevity regulating pathway - multiple species     101700695 (Akt1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101700695 (Akt1)    05205 Proteoglycans in cancer     101700695 (Akt1)    05230 Central carbon metabolism in cancer     101700695 (Akt1)    05231 Choline metabolism in cancer     101700695 (Akt1)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101700695 (Akt1)   09162 Cancer: specific types    05210 Colorectal cancer     101700695 (Akt1)    05212 Pancreatic cancer     101700695 (Akt1)    05225 Hepatocellular carcinoma     101700695 (Akt1)    05226 Gastric cancer     101700695 (Akt1)    05214 Glioma     101700695 (Akt1)    05221 Acute myeloid leukemia     101700695 (Akt1)    05220 Chronic myeloid leukemia     101700695 (Akt1)    05218 Melanoma     101700695 (Akt1)    05211 Renal cell carcinoma     101700695 (Akt1)    05215 Prostate cancer     101700695 (Akt1)    05213 Endometrial cancer     101700695 (Akt1)    05224 Breast cancer     101700695 (Akt1)    05222 Small cell lung cancer     101700695 (Akt1)    05223 Non-small cell lung cancer     101700695 (Akt1)   09164 Neurodegenerative disease    05010 Alzheimer disease     101700695 (Akt1)    05017 Spinocerebellar ataxia     101700695 (Akt1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101700695 (Akt1)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     101700695 (Akt1)    04931 Insulin resistance     101700695 (Akt1)    04933 AGE-RAGE signaling pathway in diabetic complications     101700695 (Akt1)   09171 Infectious disease: bacterial    05132 Salmonella infection     101700695 (Akt1)    05135 Yersinia infection     101700695 (Akt1)    05152 Tuberculosis     101700695 (Akt1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101700695 (Akt1)    05170 Human immunodeficiency virus 1 infection     101700695 (Akt1)    05161 Hepatitis B     101700695 (Akt1)    05160 Hepatitis C     101700695 (Akt1)    05164 Influenza A     101700695 (Akt1)    05162 Measles     101700695 (Akt1)    05168 Herpes simplex virus 1 infection     101700695 (Akt1)    05163 Human cytomegalovirus infection     101700695 (Akt1)    05167 Kaposi sarcoma-associated herpesvirus infection     101700695 (Akt1)    05169 Epstein-Barr virus infection     101700695 (Akt1)    05165 Human papillomavirus infection     101700695 (Akt1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     101700695 (Akt1)    05142 Chagas disease     101700695 (Akt1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101700695 (Akt1)    01524 Platinum drug resistance     101700695 (Akt1)    01522 Endocrine resistance     101700695 (Akt1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:hgl01001]     101700695 (Akt1) Enzymes [BR:hgl01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.1  non-specific serine/threonine protein kinase      101700695 (Akt1) Protein kinases [BR:hgl01001]  Serine/threonine kinases: AGC group   AKT/PKB family    101700695 (Akt1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH Motif Other DBs NCBI-GeneID:  101700695 NCBI-ProteinID:  XP_004836907 LinkDB All DBs Position Un AA seq 485 aa AA seqDB search MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQRESPLNNFSVAQC QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEELMEF QSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGECPLPQL FFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGL CKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHE KLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFASIMWQD VYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDNMECVDSERRPHFPQFSYS ASGTA NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt atgaacgacgtggccatcgtgaaggagggctggctgcacaagcgaggggagtacatcaag acctggcggccacgctacttcctcctcaagaacgatggcaccttcatcggctacaaggag cggccacaggacgtggaccagcgtgagtcccctctcaacaacttctccgtggcgcaatgc cagctgatgaagacggagcggcccaggcccaacaccttcatcatccgctgcctgcagtgg accacggtcattgagcgcactttccacgtggagacgccagaggagcgggaggagtggaca acagccatccagacagtggccgatgggctcaagaggcaggaggaggagctgatggagttt cagtcaggctcacccagcgacaactcgggggccgaggagatggaggtgtctctggccaag cccaagcaccgtgtgaccatgaatgagtttgaatacctgaagctgctgggcaagggcacc tttgggaaagtgatcctggtgaaggagaaggccacgggccgctactacgccatgaagatc ctaaagaaggaggtcatcgtggccaaggatgaggtggcccacacactcactgagaaccgc gtcctgcagaactccaggcatcccttcctcacggccctgaagtactccttccagacccat gaccgcctctgctttgtcatggagtacgccaacgggggcgagtgtcccctcccacagctc ttcttccacctgtcccgtgagcgtgtgttctccgaggaccgggcccgcttctacggtgcg gagattgtgtcggccttggactacctgcactctgagaagaacgtggtgtaccgagacctc aagctggagaacctcatgctggacaaggatgggcacatcaagatcacggactttgggctg tgcaaggagggcatcaaggacggcgccaccatgaagaccttctgcgggacgcctgagtac ctggcccctgaggtgctggaggacaacgactacggccgcgcagtggactggtgggggctg ggcgtggtcatgtacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgag aagctgttcgagctcatcctcatggaggagatccgcttcccacgcacgcttggccccgag gccaagtccctactctcgggactgctcaagaaggaccccaagcagaggctcggcgggggc tctgaggacgccaaggagatcatgcagcaccgcttcttcgccagcatcatgtggcaggat gtgtatgagaagaagctcagcccgcccttcaagccgcaggtcacctcggagaccgacacc aggtattttgatgaagagttcacagcccaaatgatcaccatcacgccgcccgaccaagat gacaacatggaatgtgtggacagcgagcggaggccgcacttcccacagttctcctactca gccagtggcacagcctga

Heterocephalus glaber (naked mole rat): 101701289 Help Entry 101701289         CDS       T02812                                  Gene name Akt3 Definition (RefSeq) AKT serine/threonine kinase 3   KO K04456   RAC serine/threonine-protein kinase [EC:2.7.11.1] Organism hgl  Heterocephalus glaber (naked mole rat) Pathway hgl01521   EGFR tyrosine kinase inhibitor resistance hgl01522   Endocrine resistance hgl01524   Platinum drug resistance hgl04010   MAPK signaling pathway hgl04012   ErbB signaling pathway hgl04014   Ras signaling pathway hgl04015   Rap1 signaling pathway hgl04022   cGMP-PKG signaling pathway hgl04024   cAMP signaling pathway hgl04062   Chemokine signaling pathway hgl04066   HIF-1 signaling pathway hgl04068   FoxO signaling pathway hgl04071   Sphingolipid signaling pathway hgl04072   Phospholipase D signaling pathway hgl04140   Autophagy - animal hgl04150   mTOR signaling pathway hgl04151   PI3K-Akt signaling pathway hgl04152   AMPK signaling pathway hgl04210   Apoptosis hgl04211   Longevity regulating pathway hgl04213   Longevity regulating pathway - multiple species hgl04218   Cellular senescence hgl04261   Adrenergic signaling in cardiomyocytes hgl04370   VEGF signaling pathway hgl04371   Apelin signaling pathway hgl04380   Osteoclast differentiation hgl04510   Focal adhesion hgl04550   Signaling pathways regulating pluripotency of stem cells hgl04611   Platelet activation hgl04613   Neutrophil extracellular trap formation hgl04620   Toll-like receptor signaling pathway hgl04625   C-type lectin receptor signaling pathway hgl04630   JAK-STAT signaling pathway hgl04660   T cell receptor signaling pathway hgl04662   B cell receptor signaling pathway hgl04664   Fc epsilon RI signaling pathway hgl04666   Fc gamma R-mediated phagocytosis hgl04668   TNF signaling pathway hgl04722   Neurotrophin signaling pathway hgl04725   Cholinergic synapse hgl04728   Dopaminergic synapse hgl04910   Insulin signaling pathway hgl04914   Progesterone-mediated oocyte maturation hgl04915   Estrogen signaling pathway hgl04917   Prolactin signaling pathway hgl04919   Thyroid hormone signaling pathway hgl04920   Adipocytokine signaling pathway hgl04922   Glucagon signaling pathway hgl04923   Regulation of lipolysis in adipocytes hgl04926   Relaxin signaling pathway hgl04929   GnRH secretion hgl04931   Insulin resistance hgl04932   Non-alcoholic fatty liver disease hgl04933   AGE-RAGE signaling pathway in diabetic complications hgl04935   Growth hormone synthesis, secretion and action hgl04973   Carbohydrate digestion and absorption hgl05010   Alzheimer disease hgl05017   Spinocerebellar ataxia hgl05132   Salmonella infection hgl05135   Yersinia infection hgl05142   Chagas disease hgl05145   Toxoplasmosis hgl05152   Tuberculosis hgl05160   Hepatitis C hgl05161   Hepatitis B hgl05162   Measles hgl05163   Human cytomegalovirus infection hgl05164   Influenza A hgl05165   Human papillomavirus infection hgl05166   Human T-cell leukemia virus 1 infection hgl05167   Kaposi sarcoma-associated herpesvirus infection hgl05168   Herpes simplex virus 1 infection hgl05169   Epstein-Barr virus infection hgl05170   Human immunodeficiency virus 1 infection hgl05200   Pathways in cancer hgl05205   Proteoglycans in cancer hgl05210   Colorectal cancer hgl05211   Renal cell carcinoma hgl05212   Pancreatic cancer hgl05213   Endometrial cancer hgl05214   Glioma hgl05215   Prostate cancer hgl05218   Melanoma hgl05220   Chronic myeloid leukemia hgl05221   Acute myeloid leukemia hgl05222   Small cell lung cancer hgl05223   Non-small cell lung cancer hgl05224   Breast cancer hgl05225   Hepatocellular carcinoma hgl05226   Gastric cancer hgl05230   Central carbon metabolism in cancer hgl05231   Choline metabolism in cancer hgl05235   PD-L1 expression and PD-1 checkpoint pathway in cancer hgl05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101701289 (Akt3)    04012 ErbB signaling pathway     101701289 (Akt3)    04014 Ras signaling pathway     101701289 (Akt3)    04015 Rap1 signaling pathway     101701289 (Akt3)    04370 VEGF signaling pathway     101701289 (Akt3)    04371 Apelin signaling pathway     101701289 (Akt3)    04630 JAK-STAT signaling pathway     101701289 (Akt3)    04668 TNF signaling pathway     101701289 (Akt3)    04066 HIF-1 signaling pathway     101701289 (Akt3)    04068 FoxO signaling pathway     101701289 (Akt3)    04072 Phospholipase D signaling pathway     101701289 (Akt3)    04071 Sphingolipid signaling pathway     101701289 (Akt3)    04024 cAMP signaling pathway     101701289 (Akt3)    04022 cGMP-PKG signaling pathway     101701289 (Akt3)    04151 PI3K-Akt signaling pathway     101701289 (Akt3)    04152 AMPK signaling pathway     101701289 (Akt3)    04150 mTOR signaling pathway     101701289 (Akt3)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101701289 (Akt3)   09143 Cell growth and death    04210 Apoptosis     101701289 (Akt3)    04218 Cellular senescence     101701289 (Akt3)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101701289 (Akt3)    04550 Signaling pathways regulating pluripotency of stem cells     101701289 (Akt3)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     101701289 (Akt3)    04613 Neutrophil extracellular trap formation     101701289 (Akt3)    04620 Toll-like receptor signaling pathway     101701289 (Akt3)    04625 C-type lectin receptor signaling pathway     101701289 (Akt3)    04660 T cell receptor signaling pathway     101701289 (Akt3)    04662 B cell receptor signaling pathway     101701289 (Akt3)    04664 Fc epsilon RI signaling pathway     101701289 (Akt3)    04666 Fc gamma R-mediated phagocytosis     101701289 (Akt3)    04062 Chemokine signaling pathway     101701289 (Akt3)   09152 Endocrine system    04910 Insulin signaling pathway     101701289 (Akt3)    04922 Glucagon signaling pathway     101701289 (Akt3)    04923 Regulation of lipolysis in adipocytes     101701289 (Akt3)    04920 Adipocytokine signaling pathway     101701289 (Akt3)    04929 GnRH secretion     101701289 (Akt3)    04915 Estrogen signaling pathway     101701289 (Akt3)    04914 Progesterone-mediated oocyte maturation     101701289 (Akt3)    04917 Prolactin signaling pathway     101701289 (Akt3)    04926 Relaxin signaling pathway     101701289 (Akt3)    04935 Growth hormone synthesis, secretion and action     101701289 (Akt3)    04919 Thyroid hormone signaling pathway     101701289 (Akt3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     101701289 (Akt3)   09154 Digestive system    04973 Carbohydrate digestion and absorption     101701289 (Akt3)   09156 Nervous system    04725 Cholinergic synapse     101701289 (Akt3)    04728 Dopaminergic synapse     101701289 (Akt3)    04722 Neurotrophin signaling pathway     101701289 (Akt3)   09158 Development and regeneration    04380 Osteoclast differentiation     101701289 (Akt3)   09149 Aging    04211 Longevity regulating pathway     101701289 (Akt3)    04213 Longevity regulating pathway - multiple species     101701289 (Akt3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101701289 (Akt3)    05205 Proteoglycans in cancer     101701289 (Akt3)    05230 Central carbon metabolism in cancer     101701289 (Akt3)    05231 Choline metabolism in cancer     101701289 (Akt3)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101701289 (Akt3)   09162 Cancer: specific types    05210 Colorectal cancer     101701289 (Akt3)    05212 Pancreatic cancer     101701289 (Akt3)    05225 Hepatocellular carcinoma     101701289 (Akt3)    05226 Gastric cancer     101701289 (Akt3)    05214 Glioma     101701289 (Akt3)    05221 Acute myeloid leukemia     101701289 (Akt3)    05220 Chronic myeloid leukemia     101701289 (Akt3)    05218 Melanoma     101701289 (Akt3)    05211 Renal cell carcinoma     101701289 (Akt3)    05215 Prostate cancer     101701289 (Akt3)    05213 Endometrial cancer     101701289 (Akt3)    05224 Breast cancer     101701289 (Akt3)    05222 Small cell lung cancer     101701289 (Akt3)    05223 Non-small cell lung cancer     101701289 (Akt3)   09164 Neurodegenerative disease    05010 Alzheimer disease     101701289 (Akt3)    05017 Spinocerebellar ataxia     101701289 (Akt3)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101701289 (Akt3)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     101701289 (Akt3)    04931 Insulin resistance     101701289 (Akt3)    04933 AGE-RAGE signaling pathway in diabetic complications     101701289 (Akt3)   09171 Infectious disease: bacterial    05132 Salmonella infection     101701289 (Akt3)    05135 Yersinia infection     101701289 (Akt3)    05152 Tuberculosis     101701289 (Akt3)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101701289 (Akt3)    05170 Human immunodeficiency virus 1 infection     101701289 (Akt3)    05161 Hepatitis B     101701289 (Akt3)    05160 Hepatitis C     101701289 (Akt3)    05164 Influenza A     101701289 (Akt3)    05162 Measles     101701289 (Akt3)    05168 Herpes simplex virus 1 infection     101701289 (Akt3)    05163 Human cytomegalovirus infection     101701289 (Akt3)    05167 Kaposi sarcoma-associated herpesvirus infection     101701289 (Akt3)    05169 Epstein-Barr virus infection     101701289 (Akt3)    05165 Human papillomavirus infection     101701289 (Akt3)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     101701289 (Akt3)    05142 Chagas disease     101701289 (Akt3)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101701289 (Akt3)    01524 Platinum drug resistance     101701289 (Akt3)    01522 Endocrine resistance     101701289 (Akt3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:hgl01001]     101701289 (Akt3) Enzymes [BR:hgl01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.1  non-specific serine/threonine protein kinase      101701289 (Akt3) Protein kinases [BR:hgl01001]  Serine/threonine kinases: AGC group   AKT/PKB family    101701289 (Akt3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 Motif Other DBs NCBI-GeneID:  101701289 NCBI-ProteinID:  XP_004853569 LinkDB All DBs Position Un AA seq 490 aa AA seqDB search MGHLLRVLFGGAHRRRGSTGFIRWRAGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPY PLNNFSVAKCQLMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRL QRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKA SGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVN GGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITD FGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQ DHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVN WQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFP QFSYSASGRE NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt atgggacacctcttaagagttctctttggtggagcccacaggcggagaggaagcacagga ttcataagatggcgggcgggagaatatataaaaaactggaggccaagatacttccttttg aagacagatggctcattcataggatacaaagagaaacctcaagatgtggatttaccttat cccctcaacaacttttccgtggcaaaatgccagttaatgaaaacagaacgaccaaagcca aacacatttattatcagatgtctccagtggaccactgttatagaaagaacatttcatgta gatactccagaggaaagagaagaatggacagaggctatccaagctgtagcggacagactg caaaggcaagaagaggagagaatgaattgcagtccaacttcacaaattgataatatagga gaagaagagatggatgcttctacaacccatcataaaagaaagacaatgaatgattttgac tatttgaaactactaggtaaaggcacttttgggaaagttattttggttcgagagaaagca agtgggaaatactatgctatgaagattctgaagaaagaagtcattattgcaaaggatgaa gtggcacacactctaactgaaagcagagtattaaagaacactagacatccatttttaaca tccttgaaatattccttccagacaaaagaccgtttgtgttttgtgatggaatatgttaat gggggagagctgtttttccatttgtcgagagagcgggtgttctctgaggaccgcacacgt ttctatggtgcagaaattgtctcagccttggactatctacattccggaaagattgtgtac cgtgatctcaagttggagaatttgatgctggataaagatggccacataaaaattacagat tttggactttgcaaagaagggatcacagatgcagccaccatgaagacattctgtggcaca ccagagtatctggcgccagaggtgttagaagataacgactatggccgagcagtagactgg tggggtctgggggttgtcatgtatgaaatgatgtgcggaaggttaccgttctacaaccag gaccatgagaagctttttgaattaatattaatggaagacattaaatttcctcgaacactc tcttcagatgcaaaatcattgctttcagggctcttgataaaggatccaaataaacgcctt ggtggaggaccagatgatgcaaaagaaattatgagacacagtttcttctctggagtaaac tggcaagatgtatatgataaaaagcttgtgcctccttttaagcctcaggtaacttctgag accgacaccagatattttgacgaagaattcacagctcagactattacaataacaccacct gagaaatatgacgaagatggcatggattgcatggacaatgagaggcggccgcatttccct cagttttcctattccgcaagtggacgagaataa

Heterocephalus glaber (naked mole rat): 101719164 Help Entry 101719164         CDS       T02812                                  Gene name Akt2 Definition (RefSeq) AKT serine/threonine kinase 2   KO K04456   RAC serine/threonine-protein kinase [EC:2.7.11.1] Organism hgl  Heterocephalus glaber (naked mole rat) Pathway hgl01521   EGFR tyrosine kinase inhibitor resistance hgl01522   Endocrine resistance hgl01524   Platinum drug resistance hgl04010   MAPK signaling pathway hgl04012   ErbB signaling pathway hgl04014   Ras signaling pathway hgl04015   Rap1 signaling pathway hgl04022   cGMP-PKG signaling pathway hgl04024   cAMP signaling pathway hgl04062   Chemokine signaling pathway hgl04066   HIF-1 signaling pathway hgl04068   FoxO signaling pathway hgl04071   Sphingolipid signaling pathway hgl04072   Phospholipase D signaling pathway hgl04140   Autophagy - animal hgl04150   mTOR signaling pathway hgl04151   PI3K-Akt signaling pathway hgl04152   AMPK signaling pathway hgl04210   Apoptosis hgl04211   Longevity regulating pathway hgl04213   Longevity regulating pathway - multiple species hgl04218   Cellular senescence hgl04261   Adrenergic signaling in cardiomyocytes hgl04370   VEGF signaling pathway hgl04371   Apelin signaling pathway hgl04380   Osteoclast differentiation hgl04510   Focal adhesion hgl04550   Signaling pathways regulating pluripotency of stem cells hgl04611   Platelet activation hgl04613   Neutrophil extracellular trap formation hgl04620   Toll-like receptor signaling pathway hgl04625   C-type lectin receptor signaling pathway hgl04630   JAK-STAT signaling pathway hgl04660   T cell receptor signaling pathway hgl04662   B cell receptor signaling pathway hgl04664   Fc epsilon RI signaling pathway hgl04666   Fc gamma R-mediated phagocytosis hgl04668   TNF signaling pathway hgl04722   Neurotrophin signaling pathway hgl04725   Cholinergic synapse hgl04728   Dopaminergic synapse hgl04910   Insulin signaling pathway hgl04914   Progesterone-mediated oocyte maturation hgl04915   Estrogen signaling pathway hgl04917   Prolactin signaling pathway hgl04919   Thyroid hormone signaling pathway hgl04920   Adipocytokine signaling pathway hgl04922   Glucagon signaling pathway hgl04923   Regulation of lipolysis in adipocytes hgl04926   Relaxin signaling pathway hgl04929   GnRH secretion hgl04931   Insulin resistance hgl04932   Non-alcoholic fatty liver disease hgl04933   AGE-RAGE signaling pathway in diabetic complications hgl04935   Growth hormone synthesis, secretion and action hgl04973   Carbohydrate digestion and absorption hgl05010   Alzheimer disease hgl05017   Spinocerebellar ataxia hgl05132   Salmonella infection hgl05135   Yersinia infection hgl05142   Chagas disease hgl05145   Toxoplasmosis hgl05152   Tuberculosis hgl05160   Hepatitis C hgl05161   Hepatitis B hgl05162   Measles hgl05163   Human cytomegalovirus infection hgl05164   Influenza A hgl05165   Human papillomavirus infection hgl05166   Human T-cell leukemia virus 1 infection hgl05167   Kaposi sarcoma-associated herpesvirus infection hgl05168   Herpes simplex virus 1 infection hgl05169   Epstein-Barr virus infection hgl05170   Human immunodeficiency virus 1 infection hgl05200   Pathways in cancer hgl05205   Proteoglycans in cancer hgl05210   Colorectal cancer hgl05211   Renal cell carcinoma hgl05212   Pancreatic cancer hgl05213   Endometrial cancer hgl05214   Glioma hgl05215   Prostate cancer hgl05218   Melanoma hgl05220   Chronic myeloid leukemia hgl05221   Acute myeloid leukemia hgl05222   Small cell lung cancer hgl05223   Non-small cell lung cancer hgl05224   Breast cancer hgl05225   Hepatocellular carcinoma hgl05226   Gastric cancer hgl05230   Central carbon metabolism in cancer hgl05231   Choline metabolism in cancer hgl05235   PD-L1 expression and PD-1 checkpoint pathway in cancer hgl05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101719164 (Akt2)    04012 ErbB signaling pathway     101719164 (Akt2)    04014 Ras signaling pathway     101719164 (Akt2)    04015 Rap1 signaling pathway     101719164 (Akt2)    04370 VEGF signaling pathway     101719164 (Akt2)    04371 Apelin signaling pathway     101719164 (Akt2)    04630 JAK-STAT signaling pathway     101719164 (Akt2)    04668 TNF signaling pathway     101719164 (Akt2)    04066 HIF-1 signaling pathway     101719164 (Akt2)    04068 FoxO signaling pathway     101719164 (Akt2)    04072 Phospholipase D signaling pathway     101719164 (Akt2)    04071 Sphingolipid signaling pathway     101719164 (Akt2)    04024 cAMP signaling pathway     101719164 (Akt2)    04022 cGMP-PKG signaling pathway     101719164 (Akt2)    04151 PI3K-Akt signaling pathway     101719164 (Akt2)    04152 AMPK signaling pathway     101719164 (Akt2)    04150 mTOR signaling pathway     101719164 (Akt2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101719164 (Akt2)   09143 Cell growth and death    04210 Apoptosis     101719164 (Akt2)    04218 Cellular senescence     101719164 (Akt2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101719164 (Akt2)    04550 Signaling pathways regulating pluripotency of stem cells     101719164 (Akt2)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     101719164 (Akt2)    04613 Neutrophil extracellular trap formation     101719164 (Akt2)    04620 Toll-like receptor signaling pathway     101719164 (Akt2)    04625 C-type lectin receptor signaling pathway     101719164 (Akt2)    04660 T cell receptor signaling pathway     101719164 (Akt2)    04662 B cell receptor signaling pathway     101719164 (Akt2)    04664 Fc epsilon RI signaling pathway     101719164 (Akt2)    04666 Fc gamma R-mediated phagocytosis     101719164 (Akt2)    04062 Chemokine signaling pathway     101719164 (Akt2)   09152 Endocrine system    04910 Insulin signaling pathway     101719164 (Akt2)    04922 Glucagon signaling pathway     101719164 (Akt2)    04923 Regulation of lipolysis in adipocytes     101719164 (Akt2)    04920 Adipocytokine signaling pathway     101719164 (Akt2)    04929 GnRH secretion     101719164 (Akt2)    04915 Estrogen signaling pathway     101719164 (Akt2)    04914 Progesterone-mediated oocyte maturation     101719164 (Akt2)    04917 Prolactin signaling pathway     101719164 (Akt2)    04926 Relaxin signaling pathway     101719164 (Akt2)    04935 Growth hormone synthesis, secretion and action     101719164 (Akt2)    04919 Thyroid hormone signaling pathway     101719164 (Akt2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     101719164 (Akt2)   09154 Digestive system    04973 Carbohydrate digestion and absorption     101719164 (Akt2)   09156 Nervous system    04725 Cholinergic synapse     101719164 (Akt2)    04728 Dopaminergic synapse     101719164 (Akt2)    04722 Neurotrophin signaling pathway     101719164 (Akt2)   09158 Development and regeneration    04380 Osteoclast differentiation     101719164 (Akt2)   09149 Aging    04211 Longevity regulating pathway     101719164 (Akt2)    04213 Longevity regulating pathway - multiple species     101719164 (Akt2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101719164 (Akt2)    05205 Proteoglycans in cancer     101719164 (Akt2)    05230 Central carbon metabolism in cancer     101719164 (Akt2)    05231 Choline metabolism in cancer     101719164 (Akt2)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101719164 (Akt2)   09162 Cancer: specific types    05210 Colorectal cancer     101719164 (Akt2)    05212 Pancreatic cancer     101719164 (Akt2)    05225 Hepatocellular carcinoma     101719164 (Akt2)    05226 Gastric cancer     101719164 (Akt2)    05214 Glioma     101719164 (Akt2)    05221 Acute myeloid leukemia     101719164 (Akt2)    05220 Chronic myeloid leukemia     101719164 (Akt2)    05218 Melanoma     101719164 (Akt2)    05211 Renal cell carcinoma     101719164 (Akt2)    05215 Prostate cancer     101719164 (Akt2)    05213 Endometrial cancer     101719164 (Akt2)    05224 Breast cancer     101719164 (Akt2)    05222 Small cell lung cancer     101719164 (Akt2)    05223 Non-small cell lung cancer     101719164 (Akt2)   09164 Neurodegenerative disease    05010 Alzheimer disease     101719164 (Akt2)    05017 Spinocerebellar ataxia     101719164 (Akt2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101719164 (Akt2)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     101719164 (Akt2)    04931 Insulin resistance     101719164 (Akt2)    04933 AGE-RAGE signaling pathway in diabetic complications     101719164 (Akt2)   09171 Infectious disease: bacterial    05132 Salmonella infection     101719164 (Akt2)    05135 Yersinia infection     101719164 (Akt2)    05152 Tuberculosis     101719164 (Akt2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101719164 (Akt2)    05170 Human immunodeficiency virus 1 infection     101719164 (Akt2)    05161 Hepatitis B     101719164 (Akt2)    05160 Hepatitis C     101719164 (Akt2)    05164 Influenza A     101719164 (Akt2)    05162 Measles     101719164 (Akt2)    05168 Herpes simplex virus 1 infection     101719164 (Akt2)    05163 Human cytomegalovirus infection     101719164 (Akt2)    05167 Kaposi sarcoma-associated herpesvirus infection     101719164 (Akt2)    05169 Epstein-Barr virus infection     101719164 (Akt2)    05165 Human papillomavirus infection     101719164 (Akt2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     101719164 (Akt2)    05142 Chagas disease     101719164 (Akt2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101719164 (Akt2)    01524 Platinum drug resistance     101719164 (Akt2)    01522 Endocrine resistance     101719164 (Akt2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:hgl01001]     101719164 (Akt2) Enzymes [BR:hgl01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.1  non-specific serine/threonine protein kinase      101719164 (Akt2) Protein kinases [BR:hgl01001]  Serine/threonine kinases: AGC group   AKT/PKB family    101719164 (Akt2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C Motif Other DBs NCBI-GeneID:  101719164 NCBI-ProteinID:  XP_004874230 UniProt:  A0A0P6K3T3 LinkDB All DBs Position Un AA seq 481 aa AA seqDB search MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRVPGEDPM DYKCGSPSDSSTAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH LSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE LILMEEIRFPRTLGPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIR E NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt atgaatgaggtgtctgtcatcaaagaaggctggctccacaagcgcggggaatatatcaag acgtggaggccccggtacttcctgctgaagagtgatggctccttcattgggtataaggag agacctgaggctcctgaccagactttacctcccttaaacaacttttctgtagcagaatgc cagctgatgaagaccgagaggccacggcctaacacctttgtcatacgctgcctgcagtgg accacggtcattgagaggaccttccatgtagactctccagatgagagggaggagtggatg cgggccatccagatggtcgccaacagcctcaagcagcgagtccctggtgaggatcccatg gactacaaatgtggctccccaagtgactcttccacggctgaggagatggaagtggcagtc agcaaggcacgggccaaagtgaccatgaatgactttgattatctcaaactcctcggcaag ggcacctttggcaaagtcatcctagtgcgagaaaaggccactggccgctactatgccatg aagatcctgcggaaggaagtcatcattgccaaggatgaagtcgcccacacagtcaccgag agtcgagtcctccagaacaccaggcaccccttcctcactgcactgaagtatgccttccag acccatgaccgcctgtgcttcgtgatggagtatgccaatggcggggagctcttcttccac ctgtcccgggaacgagtcttcacggaggaccgggcacggttttatggtgcagagattgtc tcggctctcgagtacttgcactcacgggacgtggtgtaccgagacatcaagctggaaaac ctcatgctggacaaagatggccacatcaagattactgactttggcctgtgcaaagagggc atcagtgatggggccaccatgaaaaccttctgtgggaccccggagtacctggcgcctgag gtactggaggacaacgactacggccgtgcagtggactggtggggactgggcgtggtcatg tatgagatgatgtgtggtcgcctgcccttctacaaccaggaccatgagcgcctcttcgag cttatcctcatggaggaaatccgtttccctcgcacacttggccctgaggccaagtccctg ctggccgggctgctgaagaaggaccccaagcagaggctcggtggggggcccagtgacgcc aaggaggtcatggagcacaggttcttcctcagcatcaactggcaagatgtggtacaaaag aagctgctgccgcccttcaaacctcaggtcacttctgaggttgacacgaggtactttgat gatgagttcactgcccagtccatcacaatcacacccccggaccgctatgacagcctgggc tcgctggagctggaccagcggacgcacttcccccagttctcttattcggccagcatccgt gagtga

DBGET integrated database retrieval system