KEGG   Heterocephalus glaber (naked mole rat): 101700695
Entry
101700695         CDS       T02812                                 

Gene name
Akt1
Definition
(RefSeq) AKT serine/threonine kinase 1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl01524  Platinum drug resistance
hgl04010  MAPK signaling pathway
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04022  cGMP-PKG signaling pathway
hgl04024  cAMP signaling pathway
hgl04062  Chemokine signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04068  FoxO signaling pathway
hgl04071  Sphingolipid signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04140  Autophagy - animal
hgl04150  mTOR signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04152  AMPK signaling pathway
hgl04210  Apoptosis
hgl04211  Longevity regulating pathway
hgl04213  Longevity regulating pathway - multiple species
hgl04218  Cellular senescence
hgl04261  Adrenergic signaling in cardiomyocytes
hgl04370  VEGF signaling pathway
hgl04371  Apelin signaling pathway
hgl04380  Osteoclast differentiation
hgl04510  Focal adhesion
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04611  Platelet activation
hgl04613  Neutrophil extracellular trap formation
hgl04620  Toll-like receptor signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04660  T cell receptor signaling pathway
hgl04662  B cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04666  Fc gamma R-mediated phagocytosis
hgl04668  TNF signaling pathway
hgl04722  Neurotrophin signaling pathway
hgl04725  Cholinergic synapse
hgl04728  Dopaminergic synapse
hgl04910  Insulin signaling pathway
hgl04914  Progesterone-mediated oocyte maturation
hgl04915  Estrogen signaling pathway
hgl04917  Prolactin signaling pathway
hgl04919  Thyroid hormone signaling pathway
hgl04920  Adipocytokine signaling pathway
hgl04922  Glucagon signaling pathway
hgl04923  Regulation of lipolysis in adipocytes
hgl04926  Relaxin signaling pathway
hgl04929  GnRH secretion
hgl04931  Insulin resistance
hgl04932  Non-alcoholic fatty liver disease
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04935  Growth hormone synthesis, secretion and action
hgl04973  Carbohydrate digestion and absorption
hgl05010  Alzheimer disease
hgl05017  Spinocerebellar ataxia
hgl05132  Salmonella infection
hgl05135  Yersinia infection
hgl05142  Chagas disease
hgl05145  Toxoplasmosis
hgl05152  Tuberculosis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05200  Pathways in cancer
hgl05205  Proteoglycans in cancer
hgl05210  Colorectal cancer
hgl05211  Renal cell carcinoma
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05220  Chronic myeloid leukemia
hgl05221  Acute myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05230  Central carbon metabolism in cancer
hgl05231  Choline metabolism in cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101700695 (Akt1)
   04012 ErbB signaling pathway
    101700695 (Akt1)
   04014 Ras signaling pathway
    101700695 (Akt1)
   04015 Rap1 signaling pathway
    101700695 (Akt1)
   04370 VEGF signaling pathway
    101700695 (Akt1)
   04371 Apelin signaling pathway
    101700695 (Akt1)
   04630 JAK-STAT signaling pathway
    101700695 (Akt1)
   04668 TNF signaling pathway
    101700695 (Akt1)
   04066 HIF-1 signaling pathway
    101700695 (Akt1)
   04068 FoxO signaling pathway
    101700695 (Akt1)
   04072 Phospholipase D signaling pathway
    101700695 (Akt1)
   04071 Sphingolipid signaling pathway
    101700695 (Akt1)
   04024 cAMP signaling pathway
    101700695 (Akt1)
   04022 cGMP-PKG signaling pathway
    101700695 (Akt1)
   04151 PI3K-Akt signaling pathway
    101700695 (Akt1)
   04152 AMPK signaling pathway
    101700695 (Akt1)
   04150 mTOR signaling pathway
    101700695 (Akt1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101700695 (Akt1)
  09143 Cell growth and death
   04210 Apoptosis
    101700695 (Akt1)
   04218 Cellular senescence
    101700695 (Akt1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101700695 (Akt1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101700695 (Akt1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101700695 (Akt1)
   04613 Neutrophil extracellular trap formation
    101700695 (Akt1)
   04620 Toll-like receptor signaling pathway
    101700695 (Akt1)
   04625 C-type lectin receptor signaling pathway
    101700695 (Akt1)
   04660 T cell receptor signaling pathway
    101700695 (Akt1)
   04662 B cell receptor signaling pathway
    101700695 (Akt1)
   04664 Fc epsilon RI signaling pathway
    101700695 (Akt1)
   04666 Fc gamma R-mediated phagocytosis
    101700695 (Akt1)
   04062 Chemokine signaling pathway
    101700695 (Akt1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101700695 (Akt1)
   04922 Glucagon signaling pathway
    101700695 (Akt1)
   04923 Regulation of lipolysis in adipocytes
    101700695 (Akt1)
   04920 Adipocytokine signaling pathway
    101700695 (Akt1)
   04929 GnRH secretion
    101700695 (Akt1)
   04915 Estrogen signaling pathway
    101700695 (Akt1)
   04914 Progesterone-mediated oocyte maturation
    101700695 (Akt1)
   04917 Prolactin signaling pathway
    101700695 (Akt1)
   04926 Relaxin signaling pathway
    101700695 (Akt1)
   04935 Growth hormone synthesis, secretion and action
    101700695 (Akt1)
   04919 Thyroid hormone signaling pathway
    101700695 (Akt1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101700695 (Akt1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101700695 (Akt1)
  09156 Nervous system
   04725 Cholinergic synapse
    101700695 (Akt1)
   04728 Dopaminergic synapse
    101700695 (Akt1)
   04722 Neurotrophin signaling pathway
    101700695 (Akt1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101700695 (Akt1)
  09149 Aging
   04211 Longevity regulating pathway
    101700695 (Akt1)
   04213 Longevity regulating pathway - multiple species
    101700695 (Akt1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101700695 (Akt1)
   05205 Proteoglycans in cancer
    101700695 (Akt1)
   05230 Central carbon metabolism in cancer
    101700695 (Akt1)
   05231 Choline metabolism in cancer
    101700695 (Akt1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101700695 (Akt1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101700695 (Akt1)
   05212 Pancreatic cancer
    101700695 (Akt1)
   05225 Hepatocellular carcinoma
    101700695 (Akt1)
   05226 Gastric cancer
    101700695 (Akt1)
   05214 Glioma
    101700695 (Akt1)
   05221 Acute myeloid leukemia
    101700695 (Akt1)
   05220 Chronic myeloid leukemia
    101700695 (Akt1)
   05218 Melanoma
    101700695 (Akt1)
   05211 Renal cell carcinoma
    101700695 (Akt1)
   05215 Prostate cancer
    101700695 (Akt1)
   05213 Endometrial cancer
    101700695 (Akt1)
   05224 Breast cancer
    101700695 (Akt1)
   05222 Small cell lung cancer
    101700695 (Akt1)
   05223 Non-small cell lung cancer
    101700695 (Akt1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101700695 (Akt1)
   05017 Spinocerebellar ataxia
    101700695 (Akt1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101700695 (Akt1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101700695 (Akt1)
   04931 Insulin resistance
    101700695 (Akt1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101700695 (Akt1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101700695 (Akt1)
   05135 Yersinia infection
    101700695 (Akt1)
   05152 Tuberculosis
    101700695 (Akt1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101700695 (Akt1)
   05170 Human immunodeficiency virus 1 infection
    101700695 (Akt1)
   05161 Hepatitis B
    101700695 (Akt1)
   05160 Hepatitis C
    101700695 (Akt1)
   05164 Influenza A
    101700695 (Akt1)
   05162 Measles
    101700695 (Akt1)
   05168 Herpes simplex virus 1 infection
    101700695 (Akt1)
   05163 Human cytomegalovirus infection
    101700695 (Akt1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101700695 (Akt1)
   05169 Epstein-Barr virus infection
    101700695 (Akt1)
   05165 Human papillomavirus infection
    101700695 (Akt1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101700695 (Akt1)
   05142 Chagas disease
    101700695 (Akt1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101700695 (Akt1)
   01524 Platinum drug resistance
    101700695 (Akt1)
   01522 Endocrine resistance
    101700695 (Akt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101700695 (Akt1)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101700695 (Akt1)
Protein kinases [BR:hgl01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101700695 (Akt1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 101700695
NCBI-ProteinID: XP_004836907
LinkDB
Position
Un
AA seq 485 aa
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEELMEF
QSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGECPLPQL
FFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGL
CKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHE
KLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFASIMWQD
VYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDNMECVDSERRPHFPQFSYS
ASGTA
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgaacgacgtggccatcgtgaaggagggctggctgcacaagcgaggggagtacatcaag
acctggcggccacgctacttcctcctcaagaacgatggcaccttcatcggctacaaggag
cggccacaggacgtggaccagcgtgagtcccctctcaacaacttctccgtggcgcaatgc
cagctgatgaagacggagcggcccaggcccaacaccttcatcatccgctgcctgcagtgg
accacggtcattgagcgcactttccacgtggagacgccagaggagcgggaggagtggaca
acagccatccagacagtggccgatgggctcaagaggcaggaggaggagctgatggagttt
cagtcaggctcacccagcgacaactcgggggccgaggagatggaggtgtctctggccaag
cccaagcaccgtgtgaccatgaatgagtttgaatacctgaagctgctgggcaagggcacc
tttgggaaagtgatcctggtgaaggagaaggccacgggccgctactacgccatgaagatc
ctaaagaaggaggtcatcgtggccaaggatgaggtggcccacacactcactgagaaccgc
gtcctgcagaactccaggcatcccttcctcacggccctgaagtactccttccagacccat
gaccgcctctgctttgtcatggagtacgccaacgggggcgagtgtcccctcccacagctc
ttcttccacctgtcccgtgagcgtgtgttctccgaggaccgggcccgcttctacggtgcg
gagattgtgtcggccttggactacctgcactctgagaagaacgtggtgtaccgagacctc
aagctggagaacctcatgctggacaaggatgggcacatcaagatcacggactttgggctg
tgcaaggagggcatcaaggacggcgccaccatgaagaccttctgcgggacgcctgagtac
ctggcccctgaggtgctggaggacaacgactacggccgcgcagtggactggtgggggctg
ggcgtggtcatgtacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgag
aagctgttcgagctcatcctcatggaggagatccgcttcccacgcacgcttggccccgag
gccaagtccctactctcgggactgctcaagaaggaccccaagcagaggctcggcgggggc
tctgaggacgccaaggagatcatgcagcaccgcttcttcgccagcatcatgtggcaggat
gtgtatgagaagaagctcagcccgcccttcaagccgcaggtcacctcggagaccgacacc
aggtattttgatgaagagttcacagcccaaatgatcaccatcacgccgcccgaccaagat
gacaacatggaatgtgtggacagcgagcggaggccgcacttcccacagttctcctactca
gccagtggcacagcctga

KEGG   Heterocephalus glaber (naked mole rat): 101701289
Entry
101701289         CDS       T02812                                 

Gene name
Akt3
Definition
(RefSeq) AKT serine/threonine kinase 3
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl01524  Platinum drug resistance
hgl04010  MAPK signaling pathway
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04022  cGMP-PKG signaling pathway
hgl04024  cAMP signaling pathway
hgl04062  Chemokine signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04068  FoxO signaling pathway
hgl04071  Sphingolipid signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04140  Autophagy - animal
hgl04150  mTOR signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04152  AMPK signaling pathway
hgl04210  Apoptosis
hgl04211  Longevity regulating pathway
hgl04213  Longevity regulating pathway - multiple species
hgl04218  Cellular senescence
hgl04261  Adrenergic signaling in cardiomyocytes
hgl04370  VEGF signaling pathway
hgl04371  Apelin signaling pathway
hgl04380  Osteoclast differentiation
hgl04510  Focal adhesion
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04611  Platelet activation
hgl04613  Neutrophil extracellular trap formation
hgl04620  Toll-like receptor signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04660  T cell receptor signaling pathway
hgl04662  B cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04666  Fc gamma R-mediated phagocytosis
hgl04668  TNF signaling pathway
hgl04722  Neurotrophin signaling pathway
hgl04725  Cholinergic synapse
hgl04728  Dopaminergic synapse
hgl04910  Insulin signaling pathway
hgl04914  Progesterone-mediated oocyte maturation
hgl04915  Estrogen signaling pathway
hgl04917  Prolactin signaling pathway
hgl04919  Thyroid hormone signaling pathway
hgl04920  Adipocytokine signaling pathway
hgl04922  Glucagon signaling pathway
hgl04923  Regulation of lipolysis in adipocytes
hgl04926  Relaxin signaling pathway
hgl04929  GnRH secretion
hgl04931  Insulin resistance
hgl04932  Non-alcoholic fatty liver disease
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04935  Growth hormone synthesis, secretion and action
hgl04973  Carbohydrate digestion and absorption
hgl05010  Alzheimer disease
hgl05017  Spinocerebellar ataxia
hgl05132  Salmonella infection
hgl05135  Yersinia infection
hgl05142  Chagas disease
hgl05145  Toxoplasmosis
hgl05152  Tuberculosis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05200  Pathways in cancer
hgl05205  Proteoglycans in cancer
hgl05210  Colorectal cancer
hgl05211  Renal cell carcinoma
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05220  Chronic myeloid leukemia
hgl05221  Acute myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05230  Central carbon metabolism in cancer
hgl05231  Choline metabolism in cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101701289 (Akt3)
   04012 ErbB signaling pathway
    101701289 (Akt3)
   04014 Ras signaling pathway
    101701289 (Akt3)
   04015 Rap1 signaling pathway
    101701289 (Akt3)
   04370 VEGF signaling pathway
    101701289 (Akt3)
   04371 Apelin signaling pathway
    101701289 (Akt3)
   04630 JAK-STAT signaling pathway
    101701289 (Akt3)
   04668 TNF signaling pathway
    101701289 (Akt3)
   04066 HIF-1 signaling pathway
    101701289 (Akt3)
   04068 FoxO signaling pathway
    101701289 (Akt3)
   04072 Phospholipase D signaling pathway
    101701289 (Akt3)
   04071 Sphingolipid signaling pathway
    101701289 (Akt3)
   04024 cAMP signaling pathway
    101701289 (Akt3)
   04022 cGMP-PKG signaling pathway
    101701289 (Akt3)
   04151 PI3K-Akt signaling pathway
    101701289 (Akt3)
   04152 AMPK signaling pathway
    101701289 (Akt3)
   04150 mTOR signaling pathway
    101701289 (Akt3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101701289 (Akt3)
  09143 Cell growth and death
   04210 Apoptosis
    101701289 (Akt3)
   04218 Cellular senescence
    101701289 (Akt3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101701289 (Akt3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101701289 (Akt3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101701289 (Akt3)
   04613 Neutrophil extracellular trap formation
    101701289 (Akt3)
   04620 Toll-like receptor signaling pathway
    101701289 (Akt3)
   04625 C-type lectin receptor signaling pathway
    101701289 (Akt3)
   04660 T cell receptor signaling pathway
    101701289 (Akt3)
   04662 B cell receptor signaling pathway
    101701289 (Akt3)
   04664 Fc epsilon RI signaling pathway
    101701289 (Akt3)
   04666 Fc gamma R-mediated phagocytosis
    101701289 (Akt3)
   04062 Chemokine signaling pathway
    101701289 (Akt3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101701289 (Akt3)
   04922 Glucagon signaling pathway
    101701289 (Akt3)
   04923 Regulation of lipolysis in adipocytes
    101701289 (Akt3)
   04920 Adipocytokine signaling pathway
    101701289 (Akt3)
   04929 GnRH secretion
    101701289 (Akt3)
   04915 Estrogen signaling pathway
    101701289 (Akt3)
   04914 Progesterone-mediated oocyte maturation
    101701289 (Akt3)
   04917 Prolactin signaling pathway
    101701289 (Akt3)
   04926 Relaxin signaling pathway
    101701289 (Akt3)
   04935 Growth hormone synthesis, secretion and action
    101701289 (Akt3)
   04919 Thyroid hormone signaling pathway
    101701289 (Akt3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101701289 (Akt3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101701289 (Akt3)
  09156 Nervous system
   04725 Cholinergic synapse
    101701289 (Akt3)
   04728 Dopaminergic synapse
    101701289 (Akt3)
   04722 Neurotrophin signaling pathway
    101701289 (Akt3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101701289 (Akt3)
  09149 Aging
   04211 Longevity regulating pathway
    101701289 (Akt3)
   04213 Longevity regulating pathway - multiple species
    101701289 (Akt3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101701289 (Akt3)
   05205 Proteoglycans in cancer
    101701289 (Akt3)
   05230 Central carbon metabolism in cancer
    101701289 (Akt3)
   05231 Choline metabolism in cancer
    101701289 (Akt3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101701289 (Akt3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101701289 (Akt3)
   05212 Pancreatic cancer
    101701289 (Akt3)
   05225 Hepatocellular carcinoma
    101701289 (Akt3)
   05226 Gastric cancer
    101701289 (Akt3)
   05214 Glioma
    101701289 (Akt3)
   05221 Acute myeloid leukemia
    101701289 (Akt3)
   05220 Chronic myeloid leukemia
    101701289 (Akt3)
   05218 Melanoma
    101701289 (Akt3)
   05211 Renal cell carcinoma
    101701289 (Akt3)
   05215 Prostate cancer
    101701289 (Akt3)
   05213 Endometrial cancer
    101701289 (Akt3)
   05224 Breast cancer
    101701289 (Akt3)
   05222 Small cell lung cancer
    101701289 (Akt3)
   05223 Non-small cell lung cancer
    101701289 (Akt3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101701289 (Akt3)
   05017 Spinocerebellar ataxia
    101701289 (Akt3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101701289 (Akt3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101701289 (Akt3)
   04931 Insulin resistance
    101701289 (Akt3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101701289 (Akt3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101701289 (Akt3)
   05135 Yersinia infection
    101701289 (Akt3)
   05152 Tuberculosis
    101701289 (Akt3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101701289 (Akt3)
   05170 Human immunodeficiency virus 1 infection
    101701289 (Akt3)
   05161 Hepatitis B
    101701289 (Akt3)
   05160 Hepatitis C
    101701289 (Akt3)
   05164 Influenza A
    101701289 (Akt3)
   05162 Measles
    101701289 (Akt3)
   05168 Herpes simplex virus 1 infection
    101701289 (Akt3)
   05163 Human cytomegalovirus infection
    101701289 (Akt3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101701289 (Akt3)
   05169 Epstein-Barr virus infection
    101701289 (Akt3)
   05165 Human papillomavirus infection
    101701289 (Akt3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101701289 (Akt3)
   05142 Chagas disease
    101701289 (Akt3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101701289 (Akt3)
   01524 Platinum drug resistance
    101701289 (Akt3)
   01522 Endocrine resistance
    101701289 (Akt3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101701289 (Akt3)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101701289 (Akt3)
Protein kinases [BR:hgl01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101701289 (Akt3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2
Other DBs
NCBI-GeneID: 101701289
NCBI-ProteinID: XP_004853569
LinkDB
Position
Un
AA seq 490 aa
MGHLLRVLFGGAHRRRGSTGFIRWRAGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPY
PLNNFSVAKCQLMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRL
QRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKA
SGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVN
GGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITD
FGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQ
DHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVN
WQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFP
QFSYSASGRE
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgggacacctcttaagagttctctttggtggagcccacaggcggagaggaagcacagga
ttcataagatggcgggcgggagaatatataaaaaactggaggccaagatacttccttttg
aagacagatggctcattcataggatacaaagagaaacctcaagatgtggatttaccttat
cccctcaacaacttttccgtggcaaaatgccagttaatgaaaacagaacgaccaaagcca
aacacatttattatcagatgtctccagtggaccactgttatagaaagaacatttcatgta
gatactccagaggaaagagaagaatggacagaggctatccaagctgtagcggacagactg
caaaggcaagaagaggagagaatgaattgcagtccaacttcacaaattgataatatagga
gaagaagagatggatgcttctacaacccatcataaaagaaagacaatgaatgattttgac
tatttgaaactactaggtaaaggcacttttgggaaagttattttggttcgagagaaagca
agtgggaaatactatgctatgaagattctgaagaaagaagtcattattgcaaaggatgaa
gtggcacacactctaactgaaagcagagtattaaagaacactagacatccatttttaaca
tccttgaaatattccttccagacaaaagaccgtttgtgttttgtgatggaatatgttaat
gggggagagctgtttttccatttgtcgagagagcgggtgttctctgaggaccgcacacgt
ttctatggtgcagaaattgtctcagccttggactatctacattccggaaagattgtgtac
cgtgatctcaagttggagaatttgatgctggataaagatggccacataaaaattacagat
tttggactttgcaaagaagggatcacagatgcagccaccatgaagacattctgtggcaca
ccagagtatctggcgccagaggtgttagaagataacgactatggccgagcagtagactgg
tggggtctgggggttgtcatgtatgaaatgatgtgcggaaggttaccgttctacaaccag
gaccatgagaagctttttgaattaatattaatggaagacattaaatttcctcgaacactc
tcttcagatgcaaaatcattgctttcagggctcttgataaaggatccaaataaacgcctt
ggtggaggaccagatgatgcaaaagaaattatgagacacagtttcttctctggagtaaac
tggcaagatgtatatgataaaaagcttgtgcctccttttaagcctcaggtaacttctgag
accgacaccagatattttgacgaagaattcacagctcagactattacaataacaccacct
gagaaatatgacgaagatggcatggattgcatggacaatgagaggcggccgcatttccct
cagttttcctattccgcaagtggacgagaataa

KEGG   Heterocephalus glaber (naked mole rat): 101719164
Entry
101719164         CDS       T02812                                 

Gene name
Akt2
Definition
(RefSeq) AKT serine/threonine kinase 2
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl01524  Platinum drug resistance
hgl04010  MAPK signaling pathway
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04022  cGMP-PKG signaling pathway
hgl04024  cAMP signaling pathway
hgl04062  Chemokine signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04068  FoxO signaling pathway
hgl04071  Sphingolipid signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04140  Autophagy - animal
hgl04150  mTOR signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04152  AMPK signaling pathway
hgl04210  Apoptosis
hgl04211  Longevity regulating pathway
hgl04213  Longevity regulating pathway - multiple species
hgl04218  Cellular senescence
hgl04261  Adrenergic signaling in cardiomyocytes
hgl04370  VEGF signaling pathway
hgl04371  Apelin signaling pathway
hgl04380  Osteoclast differentiation
hgl04510  Focal adhesion
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04611  Platelet activation
hgl04613  Neutrophil extracellular trap formation
hgl04620  Toll-like receptor signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04660  T cell receptor signaling pathway
hgl04662  B cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04666  Fc gamma R-mediated phagocytosis
hgl04668  TNF signaling pathway
hgl04722  Neurotrophin signaling pathway
hgl04725  Cholinergic synapse
hgl04728  Dopaminergic synapse
hgl04910  Insulin signaling pathway
hgl04914  Progesterone-mediated oocyte maturation
hgl04915  Estrogen signaling pathway
hgl04917  Prolactin signaling pathway
hgl04919  Thyroid hormone signaling pathway
hgl04920  Adipocytokine signaling pathway
hgl04922  Glucagon signaling pathway
hgl04923  Regulation of lipolysis in adipocytes
hgl04926  Relaxin signaling pathway
hgl04929  GnRH secretion
hgl04931  Insulin resistance
hgl04932  Non-alcoholic fatty liver disease
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04935  Growth hormone synthesis, secretion and action
hgl04973  Carbohydrate digestion and absorption
hgl05010  Alzheimer disease
hgl05017  Spinocerebellar ataxia
hgl05132  Salmonella infection
hgl05135  Yersinia infection
hgl05142  Chagas disease
hgl05145  Toxoplasmosis
hgl05152  Tuberculosis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05200  Pathways in cancer
hgl05205  Proteoglycans in cancer
hgl05210  Colorectal cancer
hgl05211  Renal cell carcinoma
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05220  Chronic myeloid leukemia
hgl05221  Acute myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05230  Central carbon metabolism in cancer
hgl05231  Choline metabolism in cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101719164 (Akt2)
   04012 ErbB signaling pathway
    101719164 (Akt2)
   04014 Ras signaling pathway
    101719164 (Akt2)
   04015 Rap1 signaling pathway
    101719164 (Akt2)
   04370 VEGF signaling pathway
    101719164 (Akt2)
   04371 Apelin signaling pathway
    101719164 (Akt2)
   04630 JAK-STAT signaling pathway
    101719164 (Akt2)
   04668 TNF signaling pathway
    101719164 (Akt2)
   04066 HIF-1 signaling pathway
    101719164 (Akt2)
   04068 FoxO signaling pathway
    101719164 (Akt2)
   04072 Phospholipase D signaling pathway
    101719164 (Akt2)
   04071 Sphingolipid signaling pathway
    101719164 (Akt2)
   04024 cAMP signaling pathway
    101719164 (Akt2)
   04022 cGMP-PKG signaling pathway
    101719164 (Akt2)
   04151 PI3K-Akt signaling pathway
    101719164 (Akt2)
   04152 AMPK signaling pathway
    101719164 (Akt2)
   04150 mTOR signaling pathway
    101719164 (Akt2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101719164 (Akt2)
  09143 Cell growth and death
   04210 Apoptosis
    101719164 (Akt2)
   04218 Cellular senescence
    101719164 (Akt2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101719164 (Akt2)
   04550 Signaling pathways regulating pluripotency of stem cells
    101719164 (Akt2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101719164 (Akt2)
   04613 Neutrophil extracellular trap formation
    101719164 (Akt2)
   04620 Toll-like receptor signaling pathway
    101719164 (Akt2)
   04625 C-type lectin receptor signaling pathway
    101719164 (Akt2)
   04660 T cell receptor signaling pathway
    101719164 (Akt2)
   04662 B cell receptor signaling pathway
    101719164 (Akt2)
   04664 Fc epsilon RI signaling pathway
    101719164 (Akt2)
   04666 Fc gamma R-mediated phagocytosis
    101719164 (Akt2)
   04062 Chemokine signaling pathway
    101719164 (Akt2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101719164 (Akt2)
   04922 Glucagon signaling pathway
    101719164 (Akt2)
   04923 Regulation of lipolysis in adipocytes
    101719164 (Akt2)
   04920 Adipocytokine signaling pathway
    101719164 (Akt2)
   04929 GnRH secretion
    101719164 (Akt2)
   04915 Estrogen signaling pathway
    101719164 (Akt2)
   04914 Progesterone-mediated oocyte maturation
    101719164 (Akt2)
   04917 Prolactin signaling pathway
    101719164 (Akt2)
   04926 Relaxin signaling pathway
    101719164 (Akt2)
   04935 Growth hormone synthesis, secretion and action
    101719164 (Akt2)
   04919 Thyroid hormone signaling pathway
    101719164 (Akt2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101719164 (Akt2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101719164 (Akt2)
  09156 Nervous system
   04725 Cholinergic synapse
    101719164 (Akt2)
   04728 Dopaminergic synapse
    101719164 (Akt2)
   04722 Neurotrophin signaling pathway
    101719164 (Akt2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101719164 (Akt2)
  09149 Aging
   04211 Longevity regulating pathway
    101719164 (Akt2)
   04213 Longevity regulating pathway - multiple species
    101719164 (Akt2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101719164 (Akt2)
   05205 Proteoglycans in cancer
    101719164 (Akt2)
   05230 Central carbon metabolism in cancer
    101719164 (Akt2)
   05231 Choline metabolism in cancer
    101719164 (Akt2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101719164 (Akt2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101719164 (Akt2)
   05212 Pancreatic cancer
    101719164 (Akt2)
   05225 Hepatocellular carcinoma
    101719164 (Akt2)
   05226 Gastric cancer
    101719164 (Akt2)
   05214 Glioma
    101719164 (Akt2)
   05221 Acute myeloid leukemia
    101719164 (Akt2)
   05220 Chronic myeloid leukemia
    101719164 (Akt2)
   05218 Melanoma
    101719164 (Akt2)
   05211 Renal cell carcinoma
    101719164 (Akt2)
   05215 Prostate cancer
    101719164 (Akt2)
   05213 Endometrial cancer
    101719164 (Akt2)
   05224 Breast cancer
    101719164 (Akt2)
   05222 Small cell lung cancer
    101719164 (Akt2)
   05223 Non-small cell lung cancer
    101719164 (Akt2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101719164 (Akt2)
   05017 Spinocerebellar ataxia
    101719164 (Akt2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101719164 (Akt2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101719164 (Akt2)
   04931 Insulin resistance
    101719164 (Akt2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101719164 (Akt2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101719164 (Akt2)
   05135 Yersinia infection
    101719164 (Akt2)
   05152 Tuberculosis
    101719164 (Akt2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101719164 (Akt2)
   05170 Human immunodeficiency virus 1 infection
    101719164 (Akt2)
   05161 Hepatitis B
    101719164 (Akt2)
   05160 Hepatitis C
    101719164 (Akt2)
   05164 Influenza A
    101719164 (Akt2)
   05162 Measles
    101719164 (Akt2)
   05168 Herpes simplex virus 1 infection
    101719164 (Akt2)
   05163 Human cytomegalovirus infection
    101719164 (Akt2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101719164 (Akt2)
   05169 Epstein-Barr virus infection
    101719164 (Akt2)
   05165 Human papillomavirus infection
    101719164 (Akt2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101719164 (Akt2)
   05142 Chagas disease
    101719164 (Akt2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101719164 (Akt2)
   01524 Platinum drug resistance
    101719164 (Akt2)
   01522 Endocrine resistance
    101719164 (Akt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101719164 (Akt2)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101719164 (Akt2)
Protein kinases [BR:hgl01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101719164 (Akt2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 101719164
NCBI-ProteinID: XP_004874230
UniProt: A0A0P6K3T3
LinkDB
Position
Un
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRVPGEDPM
DYKCGSPSDSSTAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLGPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaatgaggtgtctgtcatcaaagaaggctggctccacaagcgcggggaatatatcaag
acgtggaggccccggtacttcctgctgaagagtgatggctccttcattgggtataaggag
agacctgaggctcctgaccagactttacctcccttaaacaacttttctgtagcagaatgc
cagctgatgaagaccgagaggccacggcctaacacctttgtcatacgctgcctgcagtgg
accacggtcattgagaggaccttccatgtagactctccagatgagagggaggagtggatg
cgggccatccagatggtcgccaacagcctcaagcagcgagtccctggtgaggatcccatg
gactacaaatgtggctccccaagtgactcttccacggctgaggagatggaagtggcagtc
agcaaggcacgggccaaagtgaccatgaatgactttgattatctcaaactcctcggcaag
ggcacctttggcaaagtcatcctagtgcgagaaaaggccactggccgctactatgccatg
aagatcctgcggaaggaagtcatcattgccaaggatgaagtcgcccacacagtcaccgag
agtcgagtcctccagaacaccaggcaccccttcctcactgcactgaagtatgccttccag
acccatgaccgcctgtgcttcgtgatggagtatgccaatggcggggagctcttcttccac
ctgtcccgggaacgagtcttcacggaggaccgggcacggttttatggtgcagagattgtc
tcggctctcgagtacttgcactcacgggacgtggtgtaccgagacatcaagctggaaaac
ctcatgctggacaaagatggccacatcaagattactgactttggcctgtgcaaagagggc
atcagtgatggggccaccatgaaaaccttctgtgggaccccggagtacctggcgcctgag
gtactggaggacaacgactacggccgtgcagtggactggtggggactgggcgtggtcatg
tatgagatgatgtgtggtcgcctgcccttctacaaccaggaccatgagcgcctcttcgag
cttatcctcatggaggaaatccgtttccctcgcacacttggccctgaggccaagtccctg
ctggccgggctgctgaagaaggaccccaagcagaggctcggtggggggcccagtgacgcc
aaggaggtcatggagcacaggttcttcctcagcatcaactggcaagatgtggtacaaaag
aagctgctgccgcccttcaaacctcaggtcacttctgaggttgacacgaggtactttgat
gatgagttcactgcccagtccatcacaatcacacccccggaccgctatgacagcctgggc
tcgctggagctggaccagcggacgcacttcccccagttctcttattcggccagcatccgt
gagtga

DBGET integrated database retrieval system