KEGG   Heterocephalus glaber (naked mole rat): 101701145Help
Entry
101701145         CDS       T02812                                 

Gene name
Cacna1e
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04010  MAPK signaling pathway
hgl04020  Calcium signaling pathway
hgl04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101701145 (Cacna1e)
   04020 Calcium signaling pathway
    101701145 (Cacna1e)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101701145 (Cacna1e)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hgl04040]
    101701145 (Cacna1e)
Ion channels [BR:hgl04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101701145 (Cacna1e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 101701145
NCBI-ProteinID: XP_004853406
LinkDB All DBs
Position
Un
AA seq 2314 aa AA seqDB search
MARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMTRDSSDEHCVDISSVGTPLARASIKSTKVDGASYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRRSRPIEGLALGL
GLEKCEEERISRGGSLKGDGGDLTGALDNQRSPLSLGKREPPWLARPCHGNCDPTQQEAG
GGETVVTFEDRARHRQSQRRSRHRRVRTEGKESASASRSRSASQERSLDEVGAPEGEKDH
EFRGSHGGKEPTIHEEEQSQDLRRTNSLMEPRGSGLAGALDEPDTPLVLPQPELEVGKDT
VLAEQEPEGSSEQALLGDVQLDVGRGISQSEPDLSCITASTDKAATESTSVTVAIPEVGP
LVDSTVVHISNKTDGEASPLKEAEIKEEENEVEKKKQKKEKRETGKAMVPHSSMFIFSTT
NPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTF
EMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRV
LRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCT
DSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQ
HSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSL
EKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKY
YSAPCTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYFRDTWNIFDFITVIGSITEIIL
TDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFF
IYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCE
PDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPH
HLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAE
DMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPK
ASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALP
YLQQDPVSGLSGRSGYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLEPEVSELKSVQSS
NYGIYLPSDTQEHAGSGRASSMPRLTMDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFSM
ERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSR
CNSEERGTQADWDSPERHQSRSPSEGRSQTPNRQGTGSLSESSIPSVSDTSTPRRSRRQL
PPVPPKPRPLLSYSSLMRHAGSISPPADGSEGGSPLTSQALESNNACLTESSNSPHPQQG
QHFSPQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMP
NGHYRRRRRGGPGPGTMCGAVSDLLSDTEEDDKC
NT seq 6945 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcggcaggccggggtcgggagatggagactcggac
cagagcaggaaccggcaaggaaccccggtgccggcctcggggccggcggccgcctacaag
cagtcgaaagcgcagagggcgcggactatggctttgtacaaccccattcccgtccggcag
aactgtttcaccgtcaacagatccctgttcatcttcggagaagataacattgtcaggaaa
tacgccaagaagctcatcgattggccgccatttgagtatatgatcttggccaccatcatt
gccaactgcatcgtcttggccctggagcagcatcttcccgaggatgacaagaccccgatg
tcccgaagactggagaagacagaaccatatttcattgggatcttctgcttcgaagctggc
atcaaaatcgtcgccctagggttcatcttccataagggttcatacctccgcaatggctgg
aatgtcatggacttcattgtggtcctcagtggcatcctggccactgcgggaacccacttc
aacactcacgtggacctgaggaccctccgggctgtgcgtgtgctaaggcccttgaagctt
gtgtcagggattcctagcctgcagattgtgttgaagtccatcatgaaggccatggtgcca
cttctgcagattggccttctgctcttctttgccatccttatgtttgcaatcattggcttg
gaattctacagtgggaaattacatcgagcatgcttcatgaataattcaggtattctagaa
ggatttgatcccccacacccatgtggtgtgcaagggtgcccagctggttatgaatgcaag
gactggatcggccccaatgatgggatcacacagtttgataacatcctttttgctgtgctg
actgtcttccagtgcatcaccatggaaggatggaccaccgtgctgtacaataccaatgat
gccttaggagccacctggaattggctgtacttcatccccttgatcatcattggatccttc
tttgttttgaacctagtcctcggagtgctttctggggaatttgccaaagagagagagaga
gtggagaacaggagagcattcatgaaactgcgacgccagcagcagatagagcgtgagctg
aatggctaccgggcctggattgacaaagccgaggaagtcatgcttgctgaagaaaataaa
aatgctgggacatcagccttagaagtgcttcgaagggccaccatcaaaaggagccggacg
gaggccatgacccgagactccagcgatgagcactgcgttgatatctcttctgtgggcaca
ccacttgcccgagccagtatcaagagcacaaaggtagatggagcttcctatttccggcac
aaggaaaggcttctacgcatctctattcgccacatggttaaatcccaggtgttttactgg
atcgtcctgagccttgtggctctcaacactgcctgcgtagccatcgtacatcacaaccag
ccccagtggctcactcacctcctctactatgcagaatttttgtttctgggactcttcctc
ttggagatgtccctgaagatgtatggcatggggcctcgcctttattttcactcttcattc
aactgctttgattttggggtcacagtgggcagcatctttgaagtagtctgggcaatcttc
agacctggtacatcttttggaatcagtgttttgagagctctccggcttctaaggatattt
aaaataaccaagtattgggcatctcttcggaatttggtggtctccttgatgagctccatg
aagtccatcatcagtttgctcttcctcctcttcctcttcatcgttgtttttgctctacta
ggcatgcagctgtttggtggcaggtttaactttaatgatggaactccttcagcaaatttt
gataccttccctgcagctattatgactgtgttccagatcctgacaggggaggactggaat
gaggtgatgtacaatgggatccgttcccagggtggagtcagctcaggcatgtggtcagcc
atctacttcattgtgctcaccttgtttggaaactatacactactgaatgtcttcttagcc
attgctgtggacaatctggccaatgcccaggaactgaccaaggatgagcaggaggaagag
gaggccttcaatcagaaacatgcacttcagaaggccaaggaggtcagcccgatgtctgca
cccaacatgccttctatcgaaagagacagaaggagaagacaccacatgtcgatgtgggag
ccacgcagcagccacctgagggagcggaggcgccggcaccacatgtcagtgtgggagcag
cgcaccagccagctgaggaggcacatgcagatgtccagccaggaggccctcaacaaagag
gaggccccaccgatgaaccccctcaaccccctcaaccctctgagccccctcaacccactc
aatgcccaccccagcctctaccggaggtccaggcccattgagggcctggccctaggcttg
ggcctggaaaagtgtgaggaagaacgcatcagtcgggggggatccctcaaaggggacgga
ggggacctgaccggtgccctggacaaccagaggagccccttgtccctaggcaaacgagag
ccaccgtggctggccaggccttgtcatgggaactgtgaccccacccagcaggaggctggg
ggaggagagactgtggtgacctttgaggatcgggccaggcacaggcagagccagaggcgc
agccggcaccgtcgcgtcaggaccgaaggcaaagagtctgcgtcggcctcccggagcagg
tctgccagccaggagaggagtctggatgaagtgggggcccctgaaggggagaaggaccat
gagttccggggcagccatggtggcaaggagccaacgatccatgaagaagaacaatcccag
gacttgaggaggaccaatagtctgatggagcccagaggctctgggcttgcaggagccctt
gatgagccagacacacccctggtcctgccccagcctgagctggaagtggggaaggacaca
gtgctggcagagcaggagccagagggcagcagtgagcaagccctcctgggggatgtacag
ctggatgtgggccgaggcatcagtcagagtgagcccgacctgtcctgcatcacggccagc
accgacaaagccgccacggagagcaccagcgtcaccgtcgccatccctgaagtgggcccc
ttggtggattcgacagtggtgcacattagcaataagactgatggagaagccagtcccttg
aaggaggcagagatcaaagaggaggagaacgaagtagagaagaagaagcagaaaaaggag
aagcgagagacaggcaaagccatggtgcctcacagctccatgttcatcttcagcaccacc
aacccgatccggagggcctgccactacattgtaaacctgcgctactttgagatgtgcatt
cttctggtgatcgcagccagcagcattgccctggcagcagaggacccagtcctgaccaac
tcggagcgcaacaaagtcctgagatatttcgactatgttttcacaggcgtgttcaccttt
gagatggttataaagatgatagaccaaggcttgatcctgcaggatgggtcctacttccga
gacctctggaacatcttggactttgtggtggtggttggtgcattggtcgcctttgctcta
gcgaacgctttgggaaccaacaaggggcgtgacatcaagaccatcaagtctcttcgggtg
ctccgagttctgaggcccctgaaaacaatcaagcgcttgcccaagctcaaggctgtgttc
gactgtgtggtgacctccttgaagaatgtcttcaacatactcattgtctacaagctcttc
atgttcatctttgctgtcatcgcagttcaactcttcaagggaaagttcttttattgtaca
gacagttccaaggacacagagaaggagtgcataggcaactatgtagaccatgaaaaaaac
aagatggaggtgaagggccgggaatggaagcgccatgaattccattatgacaacatcatc
tgggccctgctgaccctcttcacagtttccacaggggaaggatggcctcaggttctgcag
cattctgtagatgtgacagaggaggaccgaggcccaagccgcagcaaccgcatggaaatg
tccatcttttacgtggtctactttgtggtctttcctttcttctttgtcaatatcttcgtg
gctctcatcatcatcaccttccaggagcaaggagacaagatgatggaggagtgtagcctg
gagaagaatgagcgggcttgcattgactttgccatcagcgccaaaccgctcacccgctac
atgccacagaacaggcacaccttccagtaccgtgtgtggcactttgtggtgtctccgtcc
tttgagtacaccatcatggccatgattgccttgaacacagtggtgctgatgatgaagtat
tactctgctccctgtacctatgagctggccctaaagtacctgaatatcgccttcaccatg
gtgttttccctggaatgtgtcctgaaggtcatcgcttttggcttcttgaactatttccga
gatacctggaatatctttgacttcatcaccgtgattggcagtatcacagaaattatcctg
acagacagcaagctggtgaacaccagtggtttcaatatgagctttctgaagctcttccga
gctgcccgtctcataaagcttctgcgtcagggctacaccatacgtattttactttggacc
tttgtgcagtccttcaaggccctcccctatgtctgccttttgattgccatgcttttcttc
atttatgccatcattgggatgcaggtatttggaaacataaaattagatgaggagagtcat
atcaaccggcacaacaatttccggagtttctttgggtccctcatgttactcttcaggagt
gccacaggtgaagcctggcaggagattatgctgtcgtgccttggggagaaaggctgcgag
cctgacaccactgcaccgtctgggcagaatgagaatgagcgctgtggcactgacctggcc
tatgtttactttgtctctttcatcttcttctgctccttcctgatgctcaacctgtttgtg
gctgtcatcatggacaactttgagtacctgactcgggactcctccatcctgggacctcac
catttggacgagtttgtccgagtgtgggcagaatatgacagagcagcatgtggccgcatc
cattacactgagatgtatgaaatgctgactctcatgtcaccaccgctaggcctcggcaag
agatgtccctccaaagtggcatataagaggttggtcctgatgaacatgccagtagctgag
gatatgactgtccacttcacctctacactaatggctctgatccggacagctctggacatt
aaaatcgccaaaggtggtgcagacaggcagcagctagactcggagctacaaaaggagacc
ctggccatctggccacacttgtcccagaagatgctggatctgcttgtgcccatgcccaaa
gcctctgacctgactgtgggcaaaatctatgcagcaatgatgatcatggactactacaaa
cagagtaaagtaaagaagcagaggcaacaactagaggaacagaaaaatgcacccatgttc
cagcgtatggagccctcgtctctgcctcaggagatcattgctaatgccaaagccctgcct
tatctccagcaggaccctgtttcaggcctgagtggccggagtggatacccttccatgagt
ccactctcccctcaggaaatattccagttggcttgtatggacccagctgatgatggacaa
ttccaggaacaacaatctctggagccagaggttagtgaattaaaaagcgtgcagtcctct
aattatggcatctaccttccttcggacacccaggagcatgcgggatctgggagggcatcc
tctatgccacgtctgactatggatccccaggtggtgacagaccctagctccatgagacgt
tcattttctaccattcgggataagcgttcaaattcctcatggttggaggaattctccatg
gagcgaagcagtgaaaatacctacaagtctcgtcgccggagttaccactcttccctgcgg
ctgtcagcccaccgcctaaactcagattcaggccacaagtctgacacccatcgctcaggg
ggcagggagcggggacgatccaaagagcgaaagcatcttctctctcctgatgtctcccgt
tgcaattctgaggagcgagggactcaggctgactgggactccccagagcgccatcagtcc
aggtcacccagtgagggcaggtcgcagacgcccaacagacagggaacaggttccctgagt
gaaagctccatcccttccgtttctgacaccagcaccccaagacgaagtcgtcggcagctc
ccacctgtcccaccaaagcctcggcccctcctttcctacagttccctgatgcgacatgct
ggcagcatctctccaccagctgatggaagcgagggtggatctcctctgacctcccaagca
ctggagagcaacaatgcttgcctgaccgagtcttccaactccccacacccccagcagggc
cagcacttttccccccagcgctacatctctgagccctacctggccctgcatgaagactcc
catgcctcagactgtggtgaggaggagacactcacctttgaagcggctgtggctacaagc
ctgggtcggtccaacaccattggctcagccccacccctgcggcacagctggcagatgccc
aatgggcattatcggcgacggaggcgtggggggcctgggcccggcacgatgtgtggagct
gtcagtgacctcctgagtgacacagaagaagacgacaaatgctag

DBGET integrated database retrieval system