KEGG   Heterocephalus glaber (naked mole rat): 101701336
Entry
101701336         CDS       T02812                                 

Gene name
Ptpn11
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 11
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04014  Ras signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04360  Axon guidance
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04650  Natural killer cell mediated cytotoxicity
hgl04670  Leukocyte transendothelial migration
hgl04722  Neurotrophin signaling pathway
hgl04920  Adipocytokine signaling pathway
hgl04931  Insulin resistance
hgl05168  Herpes simplex virus 1 infection
hgl05205  Proteoglycans in cancer
hgl05211  Renal cell carcinoma
hgl05220  Chronic myeloid leukemia
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101701336 (Ptpn11)
   04630 JAK-STAT signaling pathway
    101701336 (Ptpn11)
   04072 Phospholipase D signaling pathway
    101701336 (Ptpn11)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101701336 (Ptpn11)
   04650 Natural killer cell mediated cytotoxicity
    101701336 (Ptpn11)
   04670 Leukocyte transendothelial migration
    101701336 (Ptpn11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101701336 (Ptpn11)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101701336 (Ptpn11)
  09158 Development and regeneration
   04360 Axon guidance
    101701336 (Ptpn11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101701336 (Ptpn11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101701336 (Ptpn11)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    101701336 (Ptpn11)
   05211 Renal cell carcinoma
    101701336 (Ptpn11)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101701336 (Ptpn11)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101701336 (Ptpn11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hgl01009]
    101701336 (Ptpn11)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     101701336 (Ptpn11)
Protein phosphatases and associated proteins [BR:hgl01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    101701336 (Ptpn11)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 101701336
NCBI-ProteinID: XP_004843821
UniProt: A0A0P6JGT2
LinkDB
Position
Un
AA seq 593 aa
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQGNTERTVWQYHF
RTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILIDIIR
EKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGH
EYTNIKYSLADQASGDQSPLPPCTPTPPCAEMREDNARVYENVGLMQQQKSFR
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgacatcgcggagatggtttcacccaaacatcactggagtggaggcagaaaatctactg
ttgaccagaggagttgatggcagttttttggcgaggcccagtaaaagtaaccccggagac
ttcacactttcagttagaagaaatggagctgtcacccacatcaagattcagaacacgggt
gactactatgatctgtacggaggggagaagtttgccactttggctgagctggtccagtat
tacatggaacatcatgggcagctgaaagagaagaatggagatgttatcgagctcaaatat
ccactgaactgtgcagatcctacctctgaaaggtggtttcatggtcacctctctgggaaa
gaagcagagaaattactaaccgagaagggaaaacatggtagctttcttgtccgagagagc
cagagccaccctggagattttgttctctctgtccgcacgggtgatgacaaaggggagagc
aatgatggcaaatctaaagtgacccacgtcatgatccgctgccaggaactgaaatatgat
gttggtggaggagaacggtttgattccttgacagatctggtggagcattacaagaagaat
ccgatggtagaaacattgggcacagtactccaactcaagcagcccctcaacacaactcgt
atcaatgctgctgaaattgaaagtcgggttcgagaattgagcaaattagccgagaccaca
gataaagtcaaacaaggcttctgggaagaatttgagacactacaacaacaggagtgcaaa
cttctctacagccgaaaagagggccagaggcaagaaaataaaaacaaaaatagatacaaa
aatatcctgccctttgatcacaccagggtggtcctccacgacggtgaccccaacgagccc
gtgtctgactacatcaacgcaaacatcatcatgcctgaattcgaaaccaagtgcaacaat
tcaaagcccaaaaagagctacattgccacacaaggctgcctgcaaaacacggtgaacgac
ttttggcgaatggtgttccaggagaattctcgagtgatcgtcatgacgacaaaagaagtg
gagcgaggaaagagcaaatgtgtcaagtactggccggatgagtacgctctcaaagagtat
ggggtcatgcgcgtcaggaatgtcaaagagagtgccgcacatgactacacgctaagagaa
ctgaaactctcgaaggttggacaagggaatacggagagaacggtctggcaataccacttt
cggacctggccggaccacggcgtgcccagtgaccccgggggcgtgttagacttcctggag
gaggtccaccacaagcaggagagcatcatggacgcgggccctgtcgtggtgcactgcagt
gctggaattggccggacaggaacattcattgtgattgatatccttattgacatcatcaga
gagaaaggtgtcgactgcgacatcgatgttcccaaaaccattcaaatggtacggtctcag
aggtcagggatggtccagacagaagcacagtaccggtttatctacatggctgtccagcat
tatattgaaacactacagcgaaggattgaagaagagcagaaaagcaagaggaaagggcac
gaatataccaatattaagtattccctagcggaccaggcaagtggcgatcagagtcccctc
ccaccgtgtacgccaacaccaccctgtgcagaaatgagagaagacaatgccagagtctat
gagaacgtgggcttgatgcagcagcagaagagcttcagatga

DBGET integrated database retrieval system