KEGG   Heterocephalus glaber (naked mole rat): 101701374
Entry
101701374         CDS       T02812                                 

Gene name
Cdc42
Definition
(RefSeq) cell division cycle 42
  KO
K04393  cell division control protein 42
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04010  MAPK signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04062  Chemokine signaling pathway
hgl04144  Endocytosis
hgl04360  Axon guidance
hgl04370  VEGF signaling pathway
hgl04510  Focal adhesion
hgl04520  Adherens junction
hgl04530  Tight junction
hgl04660  T cell receptor signaling pathway
hgl04666  Fc gamma R-mediated phagocytosis
hgl04670  Leukocyte transendothelial migration
hgl04722  Neurotrophin signaling pathway
hgl04810  Regulation of actin cytoskeleton
hgl04912  GnRH signaling pathway
hgl04932  Non-alcoholic fatty liver disease
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl05100  Bacterial invasion of epithelial cells
hgl05132  Salmonella infection
hgl05135  Yersinia infection
hgl05165  Human papillomavirus infection
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
hgl05205  Proteoglycans in cancer
hgl05211  Renal cell carcinoma
hgl05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101701374 (Cdc42)
   04014 Ras signaling pathway
    101701374 (Cdc42)
   04015 Rap1 signaling pathway
    101701374 (Cdc42)
   04370 VEGF signaling pathway
    101701374 (Cdc42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101701374 (Cdc42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101701374 (Cdc42)
   04520 Adherens junction
    101701374 (Cdc42)
   04530 Tight junction
    101701374 (Cdc42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101701374 (Cdc42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101701374 (Cdc42)
   04666 Fc gamma R-mediated phagocytosis
    101701374 (Cdc42)
   04670 Leukocyte transendothelial migration
    101701374 (Cdc42)
   04062 Chemokine signaling pathway
    101701374 (Cdc42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101701374 (Cdc42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101701374 (Cdc42)
  09158 Development and regeneration
   04360 Axon guidance
    101701374 (Cdc42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101701374 (Cdc42)
   05205 Proteoglycans in cancer
    101701374 (Cdc42)
   05203 Viral carcinogenesis
    101701374 (Cdc42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101701374 (Cdc42)
   05211 Renal cell carcinoma
    101701374 (Cdc42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101701374 (Cdc42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101701374 (Cdc42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101701374 (Cdc42)
   05135 Yersinia infection
    101701374 (Cdc42)
   05100 Bacterial invasion of epithelial cells
    101701374 (Cdc42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101701374 (Cdc42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101701374 (Cdc42)
   03036 Chromosome and associated proteins [BR:hgl03036]
    101701374 (Cdc42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hgl04147]
    101701374 (Cdc42)
   04031 GTP-binding proteins [BR:hgl04031]
    101701374 (Cdc42)
Membrane trafficking [BR:hgl04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    101701374 (Cdc42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    101701374 (Cdc42)
  Macropinocytosis
   Ras GTPases
    101701374 (Cdc42)
Chromosome and associated proteins [BR:hgl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    101701374 (Cdc42)
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101701374 (Cdc42)
  Exosomal proteins of breast milk
   101701374 (Cdc42)
GTP-binding proteins [BR:hgl04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    101701374 (Cdc42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 101701374
NCBI-ProteinID: XP_004850583
UniProt: G5BI03
LinkDB
Position
Un
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAALEPP
ETQPKRKCCIF
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacaattaagtgcgttgttgtgggcgatggtgctgttggtaaaacatgtctcctg
atatcttatacaacaaacaaatttccatctgaatatgtaccaaccgtttttgacaactat
gcagtcacagttatgattggtggagagccatatactcttgggctttttgatactgcagga
caagaagattatgacagactacgaccattgagttatccacaaacagatgtatttctagtc
tgtttttcagtggtctctccatcctcatttgaaaatgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggacccaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaaacctatcactccagag
actgctgaaaagctggcccgagatctgaaggctgtcaagtatgtggagtgttctgcactc
acacagagaggtctgaagaatgtgtttgatgaggctatcctagctgccctcgagcctccg
gaaactcaacccaaaaggaagtgctgtatattctaa

KEGG   Heterocephalus glaber (naked mole rat): 101706434
Entry
101706434         CDS       T02812                                 

Gene name
Rac1
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04010  MAPK signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04024  cAMP signaling pathway
hgl04062  Chemokine signaling pathway
hgl04071  Sphingolipid signaling pathway
hgl04145  Phagosome
hgl04151  PI3K-Akt signaling pathway
hgl04310  Wnt signaling pathway
hgl04360  Axon guidance
hgl04370  VEGF signaling pathway
hgl04380  Osteoclast differentiation
hgl04510  Focal adhesion
hgl04520  Adherens junction
hgl04530  Tight junction
hgl04613  Neutrophil extracellular trap formation
hgl04620  Toll-like receptor signaling pathway
hgl04650  Natural killer cell mediated cytotoxicity
hgl04662  B cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04666  Fc gamma R-mediated phagocytosis
hgl04670  Leukocyte transendothelial migration
hgl04722  Neurotrophin signaling pathway
hgl04810  Regulation of actin cytoskeleton
hgl04932  Non-alcoholic fatty liver disease
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04972  Pancreatic secretion
hgl05014  Amyotrophic lateral sclerosis
hgl05020  Prion disease
hgl05022  Pathways of neurodegeneration - multiple diseases
hgl05100  Bacterial invasion of epithelial cells
hgl05132  Salmonella infection
hgl05135  Yersinia infection
hgl05163  Human cytomegalovirus infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
hgl05205  Proteoglycans in cancer
hgl05210  Colorectal cancer
hgl05211  Renal cell carcinoma
hgl05212  Pancreatic cancer
hgl05231  Choline metabolism in cancer
hgl05416  Viral myocarditis
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101706434 (Rac1)
   04014 Ras signaling pathway
    101706434 (Rac1)
   04015 Rap1 signaling pathway
    101706434 (Rac1)
   04310 Wnt signaling pathway
    101706434 (Rac1)
   04370 VEGF signaling pathway
    101706434 (Rac1)
   04071 Sphingolipid signaling pathway
    101706434 (Rac1)
   04024 cAMP signaling pathway
    101706434 (Rac1)
   04151 PI3K-Akt signaling pathway
    101706434 (Rac1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101706434 (Rac1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101706434 (Rac1)
   04520 Adherens junction
    101706434 (Rac1)
   04530 Tight junction
    101706434 (Rac1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101706434 (Rac1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101706434 (Rac1)
   04620 Toll-like receptor signaling pathway
    101706434 (Rac1)
   04650 Natural killer cell mediated cytotoxicity
    101706434 (Rac1)
   04662 B cell receptor signaling pathway
    101706434 (Rac1)
   04664 Fc epsilon RI signaling pathway
    101706434 (Rac1)
   04666 Fc gamma R-mediated phagocytosis
    101706434 (Rac1)
   04670 Leukocyte transendothelial migration
    101706434 (Rac1)
   04062 Chemokine signaling pathway
    101706434 (Rac1)
  09154 Digestive system
   04972 Pancreatic secretion
    101706434 (Rac1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101706434 (Rac1)
  09158 Development and regeneration
   04360 Axon guidance
    101706434 (Rac1)
   04380 Osteoclast differentiation
    101706434 (Rac1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101706434 (Rac1)
   05205 Proteoglycans in cancer
    101706434 (Rac1)
   05203 Viral carcinogenesis
    101706434 (Rac1)
   05231 Choline metabolism in cancer
    101706434 (Rac1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101706434 (Rac1)
   05212 Pancreatic cancer
    101706434 (Rac1)
   05211 Renal cell carcinoma
    101706434 (Rac1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101706434 (Rac1)
   05020 Prion disease
    101706434 (Rac1)
   05022 Pathways of neurodegeneration - multiple diseases
    101706434 (Rac1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101706434 (Rac1)
   05416 Viral myocarditis
    101706434 (Rac1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101706434 (Rac1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101706434 (Rac1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101706434 (Rac1)
   05135 Yersinia infection
    101706434 (Rac1)
   05100 Bacterial invasion of epithelial cells
    101706434 (Rac1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101706434 (Rac1)
   05163 Human cytomegalovirus infection
    101706434 (Rac1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101706434 (Rac1)
   05169 Epstein-Barr virus infection
    101706434 (Rac1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101706434 (Rac1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hgl04147]
    101706434 (Rac1)
   04031 GTP-binding proteins [BR:hgl04031]
    101706434 (Rac1)
Membrane trafficking [BR:hgl04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    101706434 (Rac1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    101706434 (Rac1)
  Macropinocytosis
   Ras GTPases
    101706434 (Rac1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    101706434 (Rac1)
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101706434 (Rac1)
  Exosomal proteins of other body fluids (saliva and urine)
   101706434 (Rac1)
  Exosomal proteins of colorectal cancer cells
   101706434 (Rac1)
  Exosomal proteins of bladder cancer cells
   101706434 (Rac1)
GTP-binding proteins [BR:hgl04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    101706434 (Rac1)
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 101706434
NCBI-ProteinID: XP_004840496
UniProt: A0A0P6IYS7
LinkDB
Position
Un
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaaaacttgcctactg
atcagttatacaaccaatgcatttcccggagaatatatccccactgtctttgacaactat
tctgccaatgttatggtagatggaaaaccagtgaatctgggcttatgggatacagctgga
caagaagattatgacagattacgtcccctctcctatccgcaaacagatgtgttcttaatt
tgcttttctcttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtacccggaa
gtgcgacaccattgtcccaacactcccatcatcttagtgggaacaaaacttgatcttagg
gatgataaagacacaattgagaaactgaaggagaagaagctgactcccatcacctatccg
cagggcttggccatggctaaggagataggtgctgtaaaatacctggagtgctcagctctc
acccaacggggcctcaagacagtgtttgacgaagctatccgagcagttctctgcccacct
cctgtcaagaagaggaagagaaaatgcctgctgttgtaa

KEGG   Heterocephalus glaber (naked mole rat): 101711269
Entry
101711269         CDS       T02812                                 

Definition
(RefSeq) cell division control protein 42 homolog
  KO
K04393  cell division control protein 42
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04010  MAPK signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04062  Chemokine signaling pathway
hgl04144  Endocytosis
hgl04360  Axon guidance
hgl04370  VEGF signaling pathway
hgl04510  Focal adhesion
hgl04520  Adherens junction
hgl04530  Tight junction
hgl04660  T cell receptor signaling pathway
hgl04666  Fc gamma R-mediated phagocytosis
hgl04670  Leukocyte transendothelial migration
hgl04722  Neurotrophin signaling pathway
hgl04810  Regulation of actin cytoskeleton
hgl04912  GnRH signaling pathway
hgl04932  Non-alcoholic fatty liver disease
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl05100  Bacterial invasion of epithelial cells
hgl05132  Salmonella infection
hgl05135  Yersinia infection
hgl05165  Human papillomavirus infection
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
hgl05205  Proteoglycans in cancer
hgl05211  Renal cell carcinoma
hgl05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101711269
   04014 Ras signaling pathway
    101711269
   04015 Rap1 signaling pathway
    101711269
   04370 VEGF signaling pathway
    101711269
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101711269
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101711269
   04520 Adherens junction
    101711269
   04530 Tight junction
    101711269
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101711269
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101711269
   04666 Fc gamma R-mediated phagocytosis
    101711269
   04670 Leukocyte transendothelial migration
    101711269
   04062 Chemokine signaling pathway
    101711269
  09152 Endocrine system
   04912 GnRH signaling pathway
    101711269
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101711269
  09158 Development and regeneration
   04360 Axon guidance
    101711269
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101711269
   05205 Proteoglycans in cancer
    101711269
   05203 Viral carcinogenesis
    101711269
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101711269
   05211 Renal cell carcinoma
    101711269
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101711269
   04933 AGE-RAGE signaling pathway in diabetic complications
    101711269
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101711269
   05135 Yersinia infection
    101711269
   05100 Bacterial invasion of epithelial cells
    101711269
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101711269
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101711269
   03036 Chromosome and associated proteins [BR:hgl03036]
    101711269
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hgl04147]
    101711269
   04031 GTP-binding proteins [BR:hgl04031]
    101711269
Membrane trafficking [BR:hgl04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    101711269
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    101711269
  Macropinocytosis
   Ras GTPases
    101711269
Chromosome and associated proteins [BR:hgl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    101711269
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101711269
  Exosomal proteins of breast milk
   101711269
GTP-binding proteins [BR:hgl04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    101711269
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU PET117
Other DBs
NCBI-GeneID: 101711269
NCBI-ProteinID: XP_004864113
LinkDB
Position
Un
AA seq 191 aa
MQTIKCIVVGDAAVGKTCLLISYTTNKFPSEYVPTVFDNYSVTIMIGGEPYTLGLFDTAG
QEDYDRLXPLSYPQTDVFLVCFSMVSPSSFENVKEKWVPEITHHCPKTPFLLVGNQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAIKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSCRCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacaattaagtgcattgttgtgggcgatgctgctgttggtaaaacatgtctcctg
atatcttatacaacaaacaaatttccatctgaatatgtaccaaccgtttttgacaattat
tcagttacaattatgattggtggagagccatatactcttgggctttttgatactgcagga
caagaggattatgacagactatgaccattgagttatccacaaacagatgtatttctagtc
tgtttttcaatggtctctccatcctcatttgaaaatgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggaaccaaattgacctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaaacctatcactccagag
actgctgaaaagctggcccgagatctgaaggctatcaagtatgtggagtgttctgcactc
acacagaaaggcctaaaaaatgtgtttgatgaagcaatattggctgccctggaacctcca
gaaccaaagaagagctgcaggtgtgtgctgctatga

KEGG   Heterocephalus glaber (naked mole rat): 101723777
Entry
101723777         CDS       T02812                                 

Gene name
Rac3
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3)
  KO
K07861  Ras-related C3 botulinum toxin substrate 3
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04010  MAPK signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04024  cAMP signaling pathway
hgl04062  Chemokine signaling pathway
hgl04071  Sphingolipid signaling pathway
hgl04310  Wnt signaling pathway
hgl04360  Axon guidance
hgl04370  VEGF signaling pathway
hgl04510  Focal adhesion
hgl04520  Adherens junction
hgl04650  Natural killer cell mediated cytotoxicity
hgl04662  B cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04810  Regulation of actin cytoskeleton
hgl05135  Yersinia infection
hgl05163  Human cytomegalovirus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05200  Pathways in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05231  Choline metabolism in cancer
hgl05416  Viral myocarditis
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101723777 (Rac3)
   04014 Ras signaling pathway
    101723777 (Rac3)
   04015 Rap1 signaling pathway
    101723777 (Rac3)
   04310 Wnt signaling pathway
    101723777 (Rac3)
   04370 VEGF signaling pathway
    101723777 (Rac3)
   04071 Sphingolipid signaling pathway
    101723777 (Rac3)
   04024 cAMP signaling pathway
    101723777 (Rac3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101723777 (Rac3)
   04520 Adherens junction
    101723777 (Rac3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101723777 (Rac3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101723777 (Rac3)
   04662 B cell receptor signaling pathway
    101723777 (Rac3)
   04664 Fc epsilon RI signaling pathway
    101723777 (Rac3)
   04062 Chemokine signaling pathway
    101723777 (Rac3)
  09158 Development and regeneration
   04360 Axon guidance
    101723777 (Rac3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101723777 (Rac3)
   05231 Choline metabolism in cancer
    101723777 (Rac3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101723777 (Rac3)
   05212 Pancreatic cancer
    101723777 (Rac3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101723777 (Rac3)
   05416 Viral myocarditis
    101723777 (Rac3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101723777 (Rac3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101723777 (Rac3)
   05163 Human cytomegalovirus infection
    101723777 (Rac3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hgl04031]
    101723777 (Rac3)
GTP-binding proteins [BR:hgl04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    101723777 (Rac3)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 101723777
NCBI-ProteinID: XP_004861057
LinkDB
Position
Un
AA seq 212 aa
MGRCIPGWRAAALEPTVAHLKAGLPRSSCSFSAVGKTCLLISYTTNAFPGEYIPTVFDNY
SANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPE
VRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSAL
TQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF
NT seq 639 nt   +upstreamnt  +downstreamnt
atggggaggtgtatcccaggttggagagccgctgctctcgagcccaccgttgcgcacctt
aaggccggcctgcccaggtcttcttgcagcttcagcgccgtggggaagacatgcctactg
atcagctacacgaccaacgccttccctggagaatacatccccaccgtttttgacaactat
tcggccaacgtgatggtagacgggaagccggtcaacctggggctgtgggacactgccggg
caggaggactatgatcggctgcggccactctcctatcctcaaactgacgtctttttgatc
tgcttctccttggtgagcccagcttccttcgagaatgttcgtgccaagtggtacccagag
gtgcggcaccactgcccccacacgcccatcctgttagtgggcaccaagcttgacctccgt
gatgacaaggacaccattgagcggctgcgggacaagaagctggcacccatcacctaccca
cagggcctggccatggcccgagagatcggctccgtcaagtacctggagtgctcggcccta
acccagcggggcctgaagacagtgtttgacgaggccatccgggcggtgctctgcccacct
cctgtgaaaaagccgggcaagaagtgcacggtcttctag

KEGG   Heterocephalus glaber (naked mole rat): 101725000
Entry
101725000         CDS       T02812                                 

Gene name
Rac2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04010  MAPK signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04024  cAMP signaling pathway
hgl04062  Chemokine signaling pathway
hgl04071  Sphingolipid signaling pathway
hgl04310  Wnt signaling pathway
hgl04360  Axon guidance
hgl04370  VEGF signaling pathway
hgl04510  Focal adhesion
hgl04520  Adherens junction
hgl04613  Neutrophil extracellular trap formation
hgl04650  Natural killer cell mediated cytotoxicity
hgl04662  B cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04666  Fc gamma R-mediated phagocytosis
hgl04670  Leukocyte transendothelial migration
hgl04810  Regulation of actin cytoskeleton
hgl05020  Prion disease
hgl05135  Yersinia infection
hgl05163  Human cytomegalovirus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05200  Pathways in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05231  Choline metabolism in cancer
hgl05416  Viral myocarditis
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101725000 (Rac2)
   04014 Ras signaling pathway
    101725000 (Rac2)
   04015 Rap1 signaling pathway
    101725000 (Rac2)
   04310 Wnt signaling pathway
    101725000 (Rac2)
   04370 VEGF signaling pathway
    101725000 (Rac2)
   04071 Sphingolipid signaling pathway
    101725000 (Rac2)
   04024 cAMP signaling pathway
    101725000 (Rac2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101725000 (Rac2)
   04520 Adherens junction
    101725000 (Rac2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101725000 (Rac2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101725000 (Rac2)
   04650 Natural killer cell mediated cytotoxicity
    101725000 (Rac2)
   04662 B cell receptor signaling pathway
    101725000 (Rac2)
   04664 Fc epsilon RI signaling pathway
    101725000 (Rac2)
   04666 Fc gamma R-mediated phagocytosis
    101725000 (Rac2)
   04670 Leukocyte transendothelial migration
    101725000 (Rac2)
   04062 Chemokine signaling pathway
    101725000 (Rac2)
  09158 Development and regeneration
   04360 Axon guidance
    101725000 (Rac2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101725000 (Rac2)
   05231 Choline metabolism in cancer
    101725000 (Rac2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101725000 (Rac2)
   05212 Pancreatic cancer
    101725000 (Rac2)
  09164 Neurodegenerative disease
   05020 Prion disease
    101725000 (Rac2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101725000 (Rac2)
   05416 Viral myocarditis
    101725000 (Rac2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101725000 (Rac2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101725000 (Rac2)
   05163 Human cytomegalovirus infection
    101725000 (Rac2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hgl04031]
    101725000 (Rac2)
GTP-binding proteins [BR:hgl04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    101725000 (Rac2)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 101725000
NCBI-ProteinID: XP_004845723
UniProt: G5BAV0
LinkDB
Position
Un
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKETIEKLKEKKLSPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRPQKRPCSLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagatggagctgtgggcaagacctgcctcctc
atcagctataccaccaacgccttccccggagagtacatccccaccgtgtttgacaactat
tcagccaatgtgatggtggacagcaagcccgtgaacctggggctgtgggacacggccggg
caggaggactacgaccgcctgcgaccgctctcctacccacagacggatgtcttcctcatc
tgcttctccctcgtcagccccgcctcctacgagaatgtccgtgccaagtggttccccgag
gtgagacaccactgccccagcacgcccatcatcctggtgggcaccaagctggacctgcga
gatgacaaggagaccatcgagaagttgaaggagaagaagctgtcgcccatcacctacccg
caaggcctggcactggccaaggagattgactctgtaaagtacctggagtgttctgccctc
acccagagaggcctgaagaccgtctttgacgaggccatccgtgctgtcctgtgccctcag
cccacgcggccacagaagcgcccctgcagcctcctctag

DBGET integrated database retrieval system