Heterocephalus glaber (naked mole rat): 101701667 Help Entry 101701667         CDS       T02812                                  Gene name Bcl2 Definition (RefSeq) BCL2, apoptosis regulator   KO K02161   apoptosis regulator Bcl-2 Organism hgl  Heterocephalus glaber (naked mole rat) Pathway hgl01521   EGFR tyrosine kinase inhibitor resistance hgl01522   Endocrine resistance hgl01524   Platinum drug resistance hgl04064   NF-kappa B signaling pathway hgl04066   HIF-1 signaling pathway hgl04071   Sphingolipid signaling pathway hgl04115   p53 signaling pathway hgl04140   Autophagy - animal hgl04141   Protein processing in endoplasmic reticulum hgl04151   PI3K-Akt signaling pathway hgl04210   Apoptosis hgl04215   Apoptosis - multiple species hgl04217   Necroptosis hgl04261   Adrenergic signaling in cardiomyocytes hgl04340   Hedgehog signaling pathway hgl04510   Focal adhesion hgl04621   NOD-like receptor signaling pathway hgl04630   JAK-STAT signaling pathway hgl04722   Neurotrophin signaling pathway hgl04725   Cholinergic synapse hgl04915   Estrogen signaling pathway hgl04928   Parathyroid hormone synthesis, secretion and action hgl04933   AGE-RAGE signaling pathway in diabetic complications hgl05014   Amyotrophic lateral sclerosis hgl05022   Pathways of neurodegeneration - multiple diseases hgl05132   Salmonella infection hgl05145   Toxoplasmosis hgl05152   Tuberculosis hgl05161   Hepatitis B hgl05162   Measles hgl05168   Herpes simplex virus 1 infection hgl05169   Epstein-Barr virus infection hgl05170   Human immunodeficiency virus 1 infection hgl05200   Pathways in cancer hgl05206   MicroRNAs in cancer hgl05210   Colorectal cancer hgl05215   Prostate cancer hgl05222   Small cell lung cancer hgl05226   Gastric cancer hgl05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101701667 (Bcl2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     101701667 (Bcl2)    04630 JAK-STAT signaling pathway     101701667 (Bcl2)    04064 NF-kappa B signaling pathway     101701667 (Bcl2)    04066 HIF-1 signaling pathway     101701667 (Bcl2)    04071 Sphingolipid signaling pathway     101701667 (Bcl2)    04151 PI3K-Akt signaling pathway     101701667 (Bcl2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101701667 (Bcl2)   09143 Cell growth and death    04210 Apoptosis     101701667 (Bcl2)    04215 Apoptosis - multiple species     101701667 (Bcl2)    04217 Necroptosis     101701667 (Bcl2)    04115 p53 signaling pathway     101701667 (Bcl2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101701667 (Bcl2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101701667 (Bcl2)   09152 Endocrine system    04915 Estrogen signaling pathway     101701667 (Bcl2)    04928 Parathyroid hormone synthesis, secretion and action     101701667 (Bcl2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     101701667 (Bcl2)   09156 Nervous system    04725 Cholinergic synapse     101701667 (Bcl2)    04722 Neurotrophin signaling pathway     101701667 (Bcl2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101701667 (Bcl2)    05206 MicroRNAs in cancer     101701667 (Bcl2)   09162 Cancer: specific types    05210 Colorectal cancer     101701667 (Bcl2)    05226 Gastric cancer     101701667 (Bcl2)    05215 Prostate cancer     101701667 (Bcl2)    05222 Small cell lung cancer     101701667 (Bcl2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101701667 (Bcl2)    05022 Pathways of neurodegeneration - multiple diseases     101701667 (Bcl2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101701667 (Bcl2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     101701667 (Bcl2)   09171 Infectious disease: bacterial    05132 Salmonella infection     101701667 (Bcl2)    05152 Tuberculosis     101701667 (Bcl2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101701667 (Bcl2)    05161 Hepatitis B     101701667 (Bcl2)    05162 Measles     101701667 (Bcl2)    05168 Herpes simplex virus 1 infection     101701667 (Bcl2)    05169 Epstein-Barr virus infection     101701667 (Bcl2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     101701667 (Bcl2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101701667 (Bcl2)    01524 Platinum drug resistance     101701667 (Bcl2)    01522 Endocrine resistance     101701667 (Bcl2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:hgl01009]     101701667 (Bcl2) Protein phosphatases and associated proteins [BR:hgl01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      101701667 (Bcl2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  101701667 NCBI-ProteinID:  XP_004858503 UniProt:  G5BGZ7 LinkDB All DBs Position Un AA seq 239 aa AA seqDB search MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDGSAAPPGAAPTPGIFSSQPGRNSPPA APRDLAARTSPPPPLAGLAAAAGPVLSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY LNRHLHTWIQDNGGWDAFVELYGPSVRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK NT seq 720 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgctgggagaacagggtatgataaccgggagatagtgatgaagtacatccac tataagctgtcccagaggggctacgagtgggatgccggagacggcagcgccgcgccccct ggggccgcccccacgcctggcatcttctcctcccagccgggtcgaaattccccgcccgct gcgccccgggacctggccgccaggacctcgccgccgccgcccctggccggcctcgccgct gccgcggggcctgtgctcagtccggtgccacctgtggtccacctgaccctccgccaggcc ggcgatgacttctcccgtcgctaccgccgcgacttcgccgagatgtccagccagctgcac ctgacgcctttcaccgcgaggggacgctttgccacggtggtggaggagctcttcagggat ggggtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggag agcgtcaaccgggagatgtcgcccctggtggacaacattgccctctggatgactgagtac ctgaaccggcacctgcacacctggatccaggataacggaggctgggacgcctttgtggag ctgtatggccccagtgttcggcctctgtttgacttctcctggctgtctttgaagactctg ctcagcctggccctggtgggagcctgcatcaccctgggtgcctacctgggacacaagtga

DBGET integrated database retrieval system