KEGG   Heterocephalus glaber (naked mole rat): 101701667
Entry
101701667         CDS       T02812                                 

Gene name
Bcl2
Definition
(RefSeq) BCL2, apoptosis regulator
  KO
K02161  apoptosis regulator Bcl-2
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl01524  Platinum drug resistance
hgl04064  NF-kappa B signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04071  Sphingolipid signaling pathway
hgl04115  p53 signaling pathway
hgl04140  Autophagy - animal
hgl04141  Protein processing in endoplasmic reticulum
hgl04151  PI3K-Akt signaling pathway
hgl04210  Apoptosis
hgl04215  Apoptosis - multiple species
hgl04217  Necroptosis
hgl04261  Adrenergic signaling in cardiomyocytes
hgl04340  Hedgehog signaling pathway
hgl04510  Focal adhesion
hgl04621  NOD-like receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04722  Neurotrophin signaling pathway
hgl04725  Cholinergic synapse
hgl04915  Estrogen signaling pathway
hgl04928  Parathyroid hormone synthesis, secretion and action
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl05014  Amyotrophic lateral sclerosis
hgl05022  Pathways of neurodegeneration - multiple diseases
hgl05132  Salmonella infection
hgl05145  Toxoplasmosis
hgl05152  Tuberculosis
hgl05161  Hepatitis B
hgl05162  Measles
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05200  Pathways in cancer
hgl05206  MicroRNAs in cancer
hgl05210  Colorectal cancer
hgl05215  Prostate cancer
hgl05222  Small cell lung cancer
hgl05226  Gastric cancer
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101701667 (Bcl2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101701667 (Bcl2)
   04630 JAK-STAT signaling pathway
    101701667 (Bcl2)
   04064 NF-kappa B signaling pathway
    101701667 (Bcl2)
   04066 HIF-1 signaling pathway
    101701667 (Bcl2)
   04071 Sphingolipid signaling pathway
    101701667 (Bcl2)
   04151 PI3K-Akt signaling pathway
    101701667 (Bcl2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101701667 (Bcl2)
  09143 Cell growth and death
   04210 Apoptosis
    101701667 (Bcl2)
   04215 Apoptosis - multiple species
    101701667 (Bcl2)
   04217 Necroptosis
    101701667 (Bcl2)
   04115 p53 signaling pathway
    101701667 (Bcl2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101701667 (Bcl2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101701667 (Bcl2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101701667 (Bcl2)
   04928 Parathyroid hormone synthesis, secretion and action
    101701667 (Bcl2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101701667 (Bcl2)
  09156 Nervous system
   04725 Cholinergic synapse
    101701667 (Bcl2)
   04722 Neurotrophin signaling pathway
    101701667 (Bcl2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101701667 (Bcl2)
   05206 MicroRNAs in cancer
    101701667 (Bcl2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101701667 (Bcl2)
   05226 Gastric cancer
    101701667 (Bcl2)
   05215 Prostate cancer
    101701667 (Bcl2)
   05222 Small cell lung cancer
    101701667 (Bcl2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101701667 (Bcl2)
   05022 Pathways of neurodegeneration - multiple diseases
    101701667 (Bcl2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101701667 (Bcl2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101701667 (Bcl2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101701667 (Bcl2)
   05152 Tuberculosis
    101701667 (Bcl2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101701667 (Bcl2)
   05161 Hepatitis B
    101701667 (Bcl2)
   05162 Measles
    101701667 (Bcl2)
   05168 Herpes simplex virus 1 infection
    101701667 (Bcl2)
   05169 Epstein-Barr virus infection
    101701667 (Bcl2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101701667 (Bcl2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101701667 (Bcl2)
   01524 Platinum drug resistance
    101701667 (Bcl2)
   01522 Endocrine resistance
    101701667 (Bcl2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hgl01009]
    101701667 (Bcl2)
Protein phosphatases and associated proteins [BR:hgl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101701667 (Bcl2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 101701667
NCBI-ProteinID: XP_004858503
UniProt: G5BGZ7
LinkDB
Position
Un
AA seq 239 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDGSAAPPGAAPTPGIFSSQPGRNSPPA
APRDLAARTSPPPPLAGLAAAAGPVLSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSVRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
NT seq 720 nt   +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtatgataaccgggagatagtgatgaagtacatccac
tataagctgtcccagaggggctacgagtgggatgccggagacggcagcgccgcgccccct
ggggccgcccccacgcctggcatcttctcctcccagccgggtcgaaattccccgcccgct
gcgccccgggacctggccgccaggacctcgccgccgccgcccctggccggcctcgccgct
gccgcggggcctgtgctcagtccggtgccacctgtggtccacctgaccctccgccaggcc
ggcgatgacttctcccgtcgctaccgccgcgacttcgccgagatgtccagccagctgcac
ctgacgcctttcaccgcgaggggacgctttgccacggtggtggaggagctcttcagggat
ggggtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggag
agcgtcaaccgggagatgtcgcccctggtggacaacattgccctctggatgactgagtac
ctgaaccggcacctgcacacctggatccaggataacggaggctgggacgcctttgtggag
ctgtatggccccagtgttcggcctctgtttgacttctcctggctgtctttgaagactctg
ctcagcctggccctggtgggagcctgcatcaccctgggtgcctacctgggacacaagtga

DBGET integrated database retrieval system