KEGG   Heterocephalus glaber (naked mole rat): 101701753
Entry
101701753         CDS       T02812                                 

Gene name
Sos2
Definition
(RefSeq) SOS Ras/Rho guanine nucleotide exchange factor 2
  KO
K03099  son of sevenless
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl04010  MAPK signaling pathway
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04062  Chemokine signaling pathway
hgl04068  FoxO signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04150  mTOR signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04510  Focal adhesion
hgl04540  Gap junction
hgl04630  JAK-STAT signaling pathway
hgl04650  Natural killer cell mediated cytotoxicity
hgl04660  T cell receptor signaling pathway
hgl04662  B cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04714  Thermogenesis
hgl04722  Neurotrophin signaling pathway
hgl04810  Regulation of actin cytoskeleton
hgl04910  Insulin signaling pathway
hgl04912  GnRH signaling pathway
hgl04915  Estrogen signaling pathway
hgl04917  Prolactin signaling pathway
hgl04926  Relaxin signaling pathway
hgl04935  Growth hormone synthesis, secretion and action
hgl05034  Alcoholism
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05163  Human cytomegalovirus infection
hgl05165  Human papillomavirus infection
hgl05200  Pathways in cancer
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05210  Colorectal cancer
hgl05211  Renal cell carcinoma
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05220  Chronic myeloid leukemia
hgl05221  Acute myeloid leukemia
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101701753 (Sos2)
   04012 ErbB signaling pathway
    101701753 (Sos2)
   04014 Ras signaling pathway
    101701753 (Sos2)
   04630 JAK-STAT signaling pathway
    101701753 (Sos2)
   04068 FoxO signaling pathway
    101701753 (Sos2)
   04072 Phospholipase D signaling pathway
    101701753 (Sos2)
   04151 PI3K-Akt signaling pathway
    101701753 (Sos2)
   04150 mTOR signaling pathway
    101701753 (Sos2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101701753 (Sos2)
   04540 Gap junction
    101701753 (Sos2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101701753 (Sos2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101701753 (Sos2)
   04660 T cell receptor signaling pathway
    101701753 (Sos2)
   04662 B cell receptor signaling pathway
    101701753 (Sos2)
   04664 Fc epsilon RI signaling pathway
    101701753 (Sos2)
   04062 Chemokine signaling pathway
    101701753 (Sos2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101701753 (Sos2)
   04912 GnRH signaling pathway
    101701753 (Sos2)
   04915 Estrogen signaling pathway
    101701753 (Sos2)
   04917 Prolactin signaling pathway
    101701753 (Sos2)
   04926 Relaxin signaling pathway
    101701753 (Sos2)
   04935 Growth hormone synthesis, secretion and action
    101701753 (Sos2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101701753 (Sos2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101701753 (Sos2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101701753 (Sos2)
   05206 MicroRNAs in cancer
    101701753 (Sos2)
   05205 Proteoglycans in cancer
    101701753 (Sos2)
   05231 Choline metabolism in cancer
    101701753 (Sos2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101701753 (Sos2)
   05225 Hepatocellular carcinoma
    101701753 (Sos2)
   05226 Gastric cancer
    101701753 (Sos2)
   05214 Glioma
    101701753 (Sos2)
   05221 Acute myeloid leukemia
    101701753 (Sos2)
   05220 Chronic myeloid leukemia
    101701753 (Sos2)
   05211 Renal cell carcinoma
    101701753 (Sos2)
   05215 Prostate cancer
    101701753 (Sos2)
   05213 Endometrial cancer
    101701753 (Sos2)
   05224 Breast cancer
    101701753 (Sos2)
   05223 Non-small cell lung cancer
    101701753 (Sos2)
  09165 Substance dependence
   05034 Alcoholism
    101701753 (Sos2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101701753 (Sos2)
   05160 Hepatitis C
    101701753 (Sos2)
   05163 Human cytomegalovirus infection
    101701753 (Sos2)
   05165 Human papillomavirus infection
    101701753 (Sos2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101701753 (Sos2)
   01522 Endocrine resistance
    101701753 (Sos2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hgl04990]
    101701753 (Sos2)
Domain-containing proteins not elsewhere classified [BR:hgl04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   101701753 (Sos2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH PH_19 PH_13
Other DBs
NCBI-GeneID: 101701753
NCBI-ProteinID: XP_004835636
LinkDB
Position
Un
AA seq 1324 aa
MQQAPQPYEFFSEENSSKWRGLLVSALRKVQVQVHPTLSANEESLYYIEELIFQLLSKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLISLCEDEPSSSGELNYYDLIRTEIAEERQYLRELNMIIKVFREAFLSDRKLFKPSDI
EKIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPAYNEHFSKLMARPTVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKA
CSEEQEDRECLNQAITALMNLQGSMDRIYKQHSPRRRPGDPVCPFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGSLTRIGAKHERHIFLFDGLMISCKPNHGQTRLPG
YSSAEYRLKEKFVMRKIQICDKEDTCECKHAFELVSKDENSIIFAAKSAEEKNNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPEVYHFVVKDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKLA
IEKGEQPISADLKRFRKEYVQPVQLRVLNVFRHWVEHHFYDFERDLELLERLESFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQFETFDLMTLHPI
EVARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRKILD
EAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLRKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGSSSEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSTFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPYKISFSRIAESELESTV
SAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPQSRSFFSSCSSLNKLS
EEPLVPPPLPPRKKFDHDASNSKGTMKSDDDPPAIPPRQPPPPKVKPRVPVPTGAFDGPL
HSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQPPPLGHFHRDVSTCPNSPSTPPSTP
SPRVPRRVLSSSHNSLAHPPAPPVPPRQNSSPHLPKLPPKTYKRELSHPPLYRLPLVENA
ETPQ
NT seq 3975 nt   +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccgtatgagttcttcagcgaggaaaacagctcgaaatggcgg
ggactgctggtctcggccctgcggaaggttcaagtgcaagtacatccaactctctcagct
aatgaagagtctctctattacattgaagagctgatttttcagctgcttagtaaattatgc
atggcccaaccaaggactgttcaagatgtggaggaacgagttcaaaagacctttcctcat
ccaattgataaatgggctattgcggatgcacaatctgccatagagaaacgaaagcgaaga
aatcctcttttattgcctgtggacaaaatccatccttctttgaaggaagttttggggtat
aaagtggactaccatgtgtccctgtatattgtggctgtactggagtacatctcagcagat
attttaaaattggctggtaattatgtttttaatatccgacattatgaaatatctcagcag
gacatcaaagtgtcgatgtgtgcagataaggttttgatggacatgtttgatcaggatgat
ataggtttgatttctttgtgcgaagatgaacctagttcttcaggtgaattaaactactat
gacctcatcagaactgaaattgcagaagaaagacagtatcttcgggaactgaacatgatc
ataaaagtgtttcgagaagcctttctttctgacagaaagttatttaaaccttctgatatt
gaaaagatttttagtaacatttcagatatacatgaattgactgtgaaacttttaggtttg
attgaagacacagttgaaatgactgatgaaagcagtcctcatcccttagcgggcagctgt
tttgaggatttggcagaagagcaagcatttgatccttatgaaacattatcacaggacatt
ctatcaccagcatataatgaacatttcagtaagctgatggccagacctacagttgctctg
cactttcagtccattgctgatggctttaaagaggcagtccgctatgtacttccacgcctt
atgttggtaccagtgtatcattgttggcattattttgaattattaaagcaattgaaagca
tgtagtgaagagcaagaagacagagaatgtttgaatcaagctatcactgctctcatgaat
ctccaaggtagcatggaccggatttacaagcagcattctcctcggcgccggcccggggat
cctgtttgccctttttataatcgtcaattaagaagcaagcacctggctatcaaaaaaatg
aatgaaattcagaaaaacatagatggatgggaaggcaaagatattggacagtgttgtaat
gaattcataatggaaggatcgttgacaagaattggtgctaaacatgagcggcacattttt
ctctttgatggcctaatgatcagctgtaaacctaatcatggccagactcggcttccaggt
tacagtagtgcagaatatagattaaaagaaaagtttgtcatgaggaaaatacaaatctgt
gataaagaagatacttgtgagtgcaaacatgcctttgaattagtatccaaagatgaaaac
agcataatatttgctgctaagtctgctgaagagaaaaataattggatggcagcacttatt
tctcttcattatcgtagcactctagatcgaatgctagattctgtattactgaaggaagaa
aatgagcaaccactgagattaccaagtccagaagtgtatcattttgtggtaaaagactct
gaggaaaacattgttttcgaagacaacttgcaaagtagaagtggaatccccattattaaa
ggaggaactgtggtgaagttaattgaaaggttaacatatcatatgtatgcagatcccaat
tttgtccgtacttttcttaccacatatcgttcattttgtaaaccacaggaattgctaagc
ttactgatcgaacgatttgaaatcccagagccagaacctactgaagcagacaaattggca
atagagaaaggcgagcaaccaatcagtgctgacttaaaaagatttcgcaaggaatatgtt
cagccagtacaacttagggtcttaaatgtgtttcggcactgggtcgaacaccatttttat
gactttgaaagagacttggaattgcttgaaagactagaatccttcatttcaagtgtaaga
gggaaagccatgaagaaatgggtagagtcaattgctaagatcatcaagaggaagaagcaa
gcgcaggcaaatggaataagccataatattacctttgaaagtccacctcctccaattgaa
tggcatatcagtaggcctggacagtttgaaacatttgatctcatgacccttcatccaata
gaagttgcacgtcagctaacacttttggaatctgatctctacaggaaagtccaaccttct
gaacttgtagggagtgtgtggaccaaagaagataaagaaataaattctccaaatttattg
aaaatgattcgccataccacaaatctcactctctggtttgaaaaatgcattgtggaagct
gaaaattttgaagaacgggtggcagtactaagtagaattatagaaattctgcaagttttt
caagatttgaataatttcaatggtgtattggagatagtcagtgccgtaaattcagtgtca
gtgtacagactagaccatacctttgaggcattgcaggaaagaaaacggaaaattttggat
gaagctgtggaattaagtcaagatcactttaaaaaatacctagtaaaactgaagtcaatc
aatccaccttgtgtgcctttttttggaatatatttaacaaatattctgaagaccgaagaa
gggaataatgattttttaagaaagaaagggaaagatctaatcaatttcagtaaaaggagg
aaagtagctgaaattactggagaaattcagcagtatcagaatcagccttattgtttacgg
atagaaccagaaatgaggaggttctttgaaaatcttaaccccatgggaagttcatctgaa
aaagagtttacagattatttgttcaacaagtcactagaaattgaaccccgaaactgcaaa
cagccacctcgatttcctaggaaatcaactttctccttaaaatctcctgggataaggcct
aatacaggccgacatggctctacctcaggcactttacgaggtcatccaacaccgttggaa
agagaaccatataagataagctttagtcggattgctgaaagtgagctggaatcaacagtt
tcagcacccacctctccaaatacaccatctactccaccagtttctgcttcttcagacctt
agtgtgtttttagatgtggatctcaatagttcctgtggcagcaatagcatctttgctcca
gtgctcttgccacaatcaaggtctttcttcagttcatgcagtagtttaaataaactaagt
gaagagccactggttcctcctcctcttcctcctcgaaagaagtttgatcatgatgcttcg
aattccaagggaactatgaaatctgatgatgaccctcctgctattccaccaagacagcct
cctcctccaaaggtaaaacccagagttcctgttcctactggtgcatttgatgggcctctt
catagtccacctccaccaccaccaagagatcctcttcctgacacccctcctccggttccc
cttcggcctccagaacattttataaactgtccatttaatcttcagccacctccactggga
cattttcacagagatgttagtacatgtccaaattcgccaagcactcctcctagcacaccc
tctccaagggtgccgcgtcgtgttctcagttctagtcacaacagtctggctcatcctcca
gctccccctgttccaccacggcaaaattcaagccctcaccttccaaaactgccaccaaag
acttacaaacgggagctttcgcaccccccactgtacagactgcctttggtagaaaatgca
gaaactcctcaatga

KEGG   Heterocephalus glaber (naked mole rat): 101707893
Entry
101707893         CDS       T02812                                 

Gene name
Sos1
Definition
(RefSeq) SOS Ras/Rac guanine nucleotide exchange factor 1
  KO
K03099  son of sevenless
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl04010  MAPK signaling pathway
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04062  Chemokine signaling pathway
hgl04068  FoxO signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04150  mTOR signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04510  Focal adhesion
hgl04540  Gap junction
hgl04630  JAK-STAT signaling pathway
hgl04650  Natural killer cell mediated cytotoxicity
hgl04660  T cell receptor signaling pathway
hgl04662  B cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04714  Thermogenesis
hgl04722  Neurotrophin signaling pathway
hgl04810  Regulation of actin cytoskeleton
hgl04910  Insulin signaling pathway
hgl04912  GnRH signaling pathway
hgl04915  Estrogen signaling pathway
hgl04917  Prolactin signaling pathway
hgl04926  Relaxin signaling pathway
hgl04935  Growth hormone synthesis, secretion and action
hgl05034  Alcoholism
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05163  Human cytomegalovirus infection
hgl05165  Human papillomavirus infection
hgl05200  Pathways in cancer
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05210  Colorectal cancer
hgl05211  Renal cell carcinoma
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05220  Chronic myeloid leukemia
hgl05221  Acute myeloid leukemia
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101707893 (Sos1)
   04012 ErbB signaling pathway
    101707893 (Sos1)
   04014 Ras signaling pathway
    101707893 (Sos1)
   04630 JAK-STAT signaling pathway
    101707893 (Sos1)
   04068 FoxO signaling pathway
    101707893 (Sos1)
   04072 Phospholipase D signaling pathway
    101707893 (Sos1)
   04151 PI3K-Akt signaling pathway
    101707893 (Sos1)
   04150 mTOR signaling pathway
    101707893 (Sos1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101707893 (Sos1)
   04540 Gap junction
    101707893 (Sos1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101707893 (Sos1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101707893 (Sos1)
   04660 T cell receptor signaling pathway
    101707893 (Sos1)
   04662 B cell receptor signaling pathway
    101707893 (Sos1)
   04664 Fc epsilon RI signaling pathway
    101707893 (Sos1)
   04062 Chemokine signaling pathway
    101707893 (Sos1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101707893 (Sos1)
   04912 GnRH signaling pathway
    101707893 (Sos1)
   04915 Estrogen signaling pathway
    101707893 (Sos1)
   04917 Prolactin signaling pathway
    101707893 (Sos1)
   04926 Relaxin signaling pathway
    101707893 (Sos1)
   04935 Growth hormone synthesis, secretion and action
    101707893 (Sos1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101707893 (Sos1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101707893 (Sos1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101707893 (Sos1)
   05206 MicroRNAs in cancer
    101707893 (Sos1)
   05205 Proteoglycans in cancer
    101707893 (Sos1)
   05231 Choline metabolism in cancer
    101707893 (Sos1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101707893 (Sos1)
   05225 Hepatocellular carcinoma
    101707893 (Sos1)
   05226 Gastric cancer
    101707893 (Sos1)
   05214 Glioma
    101707893 (Sos1)
   05221 Acute myeloid leukemia
    101707893 (Sos1)
   05220 Chronic myeloid leukemia
    101707893 (Sos1)
   05211 Renal cell carcinoma
    101707893 (Sos1)
   05215 Prostate cancer
    101707893 (Sos1)
   05213 Endometrial cancer
    101707893 (Sos1)
   05224 Breast cancer
    101707893 (Sos1)
   05223 Non-small cell lung cancer
    101707893 (Sos1)
  09165 Substance dependence
   05034 Alcoholism
    101707893 (Sos1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101707893 (Sos1)
   05160 Hepatitis C
    101707893 (Sos1)
   05163 Human cytomegalovirus infection
    101707893 (Sos1)
   05165 Human papillomavirus infection
    101707893 (Sos1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101707893 (Sos1)
   01522 Endocrine resistance
    101707893 (Sos1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hgl04990]
    101707893 (Sos1)
Domain-containing proteins not elsewhere classified [BR:hgl04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   101707893 (Sos1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 101707893
NCBI-ProteinID: XP_004839392
UniProt: G5CA65
LinkDB
Position
Un
AA seq 1333 aa
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESNDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSAN
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDHFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTNEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSAEVYRFAEPDSEENIIFEENMQPKAGIPI
IKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDTDLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHTETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKKFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTIFIQVTLPHGPRSASVSSISL
TKGTDEVPIPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSISD
RTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPP
PQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMH
RDGPPLLENAHSS
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccctacgagtttttcagcgaggagaacgcgcccaagtggcgg
ggtctgctggtgccagcgctgaagaaggtccaggggcaggttcatccaactcttgagtct
aatgatgatgctctgcagtatgttgaagaattaattttgcaattattaaatatgctctgc
caagctcagccccgaagtgcttcagatgtagaggaacgtgtgcaaaaaagtttccctcat
ccaattgataagtgggcaatagctgatgcccagtcagctattgaaaagagaaagcggaga
aaccccttatctctcccagtagaaaaaattcatcctttattaaaggaggtcctaggttat
aaaattgatcaccaagtttctgtttacatagtagcagtattagaatatatttctgcagac
attttaaagctggtggggaattatgtgagaaatatacgacattatgaaattacaaaacaa
gatattaaagtggcaatgtgcgctgataaggtattgatggatatgtttcatcaagacgta
gaagatataaatatattatctttaacggatgaagagccttccacctcaggagaacaaact
tactatgatttggtaaaagcatttatggcagaaattcgacaatatataagggaactaaat
ctaattataaaagtttttagagagccctttgtctccaattccaaattgttttcagctaat
gatgttgaaaatatatttagtcggatagtagatatacatgaacttagtgtgaagttactg
ggccatatagaagatactgtagaaatgacagatgaaggcagtccccatcccttagtagga
agctgctttgaagacttagcagaggaactggcatttgatccatatgaatcgtatgctcga
gatattttgcgacctggttttcatgatcatttccttagtcagttatcaaagcctggggca
gcactttatttgcagtcaataggcgaaggtttcaaagaagctgttcaatatgttttaccc
aggctacttctagcccctgtttaccactgcctacattactttgaacttctgaagcagtta
gaggaaaagagtgaagatcaagaagacaaggaatgtttgaaacaagcaataacagctttg
cttaatgttcaaagtggtatggaaaaaatatgttctaaaagtcttgcaaaacgaagactg
agtgaatctgcctgtcggttttatagtcagcaaatgaaggggaaacaactagcaatcaag
aaaatgaatgagattcagaagaatattgatggttgggagggaaaagatattggacaatgt
tgcaatgagtttataatggaggggactcttacacgtgtaggagccaagcatgagagacac
atatttctttttgatggcttaatgatttgctgtaaatcaaatcatgggcagccaagactt
cctggtgctagcaatgcagaatatcgtcttaaagaaaagttttttatgcgaaaggtacaa
attaatgataaagatgacaccaatgaatacaaacatgcttttgaaataattctaaaagat
gaaaatagtgttatattttctgccaagtcagctgaagagaaaaacaattggatggcagca
ctgatatctttacagtacaggagtaccctggaaaggatgcttgatgtaacaatgctgcag
gaagagaaggaggagcagatgaggctgcctagcgctgaggtgtataggtttgcagagcct
gattctgaagagaatattatatttgaagagaacatgcagcctaaggccgggattccaatt
atcaaagcaggaactgttattaaacttatagagaggctaacataccatatgtatgcagat
cccaattttgttcggacatttcttacaacgtacagatcattttgcaaacctcaagaactg
ctgagtcttataatagaaaggtttgaaattccagagcctgagccaacagaagctgatcgc
atagctatagagaatggagatcaacccttgagtgcagaactgaagagatttagaaaagaa
tatatacagcctgtacaactgcgagtattaaatgtatgtcggcactgggtagaacaccac
ttttatgactttgaaagagatacagatcttttgcaacgaatggaggaatttattggaaca
gtaagaggtaaagcaatgaaaaaatgggttgagtccatcactaagataatccagaggaaa
aaaattgccagagacaatggaccaggtcataatattacatttcagagttcacctcccaca
gttgagtggcatataagcagacccggacacacagagacttttgacctgctcaccttacac
ccaatagaaattgctcgacaactcactttacttgaatcagatctgtaccgagctgtgcaa
ccatcagagttagttggaagtgtgtggacaaaagaagacaaagaaattaattcgcccaat
cttctgaaaatgatccgacacaccactaacctcactctgtggtttgagaagtgtattgta
gaaactgaaaatttagaagaaagagtagctgtggtgagtcgaataattgagattctacaa
gtctttcaagagctaaacaacttcaatggtgtcctggaggttgtcagtgctatgaactca
tcacctgtttacagactagaccacacatttgagcaaatacccagtcgccaaaagaaaatt
ttagaggaagctcatgaattgagtgaagatcactataagaaatatttggcaaaactcagg
tctattaatccaccatgtgtgcctttctttggaatttatctcactaatatcttaaaaaca
gaagaaggcaaccctgaggtcctaaaaagacatggaaaagagctaataaactttagcaaa
aggagaaaagtagcagaaataacaggagagatccagcagtaccaaaatcagccttattgt
ttacgagtagaatcagatatcaaaaagttctttgaaaacttgaatccaatgggaaatagc
atggagaaagaatttacagattatcttttcaacaaatccctagaaatagaaccacgaaac
cccaagcctctcccaagatttccaaaaaaatatagctatcccctaaaatctcctggtgtt
cgtccatcaaacccaagaccgggtaccatgaggcatcccacacctctacagcaggagcca
aggaaaattagttatagtaggatccctgaaagtgaaacagaaagtacagcatctgcacca
aattctccaagaacaccgctaacacctcctcctgcttctggtgcttccagtaccacagat
gtttgcagcgtgtttgattctgatcattcaagcccttttcactcaagcagcgataccatc
tttatccaagttacacttccccatggcccaagatctgcgtcagtatcatctataagttta
accaagggcactgatgaagtgcccatccccccgcctgttcctccacgaagacgaccagaa
tctgccccagctgaatcttcgccatctaagattatgtctaagcacttggacagcccccca
gccattcctcctaggcaacccacatcaaaagcctattcaccacgatactcaatatcagat
cggacctctatatcagaccctcctgagagccctcccttattaccaccacgagagcctgtg
aggacacctgatgttttctcaagctcaccactacatctccaacctccccctttgggcaaa
aagagtgaccatggcaatgccttcttcccaaacagcccttccccttttacaccacctcct
cctcaaaccccttctcctcatggcacaagaaggcatctgccatcaccaccattgacacaa
gaagtggacctccattccattgctgggccgcctgttcctccacgacaaagcacttctcaa
catatccctaaactccctccaaaaacttacaaaagggagcacacacacccatccatgcac
agagatggaccaccactgttggagaatgcccattcttcctga

DBGET integrated database retrieval system