KEGG   Heterocephalus glaber (naked mole rat): 101701769
Entry
101701769         CDS       T02812                                 

Gene name
Tp53
Definition
(RefSeq) tumor protein p53
  KO
K04451  tumor protein p53
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01522  Endocrine resistance
hgl01524  Platinum drug resistance
hgl04010  MAPK signaling pathway
hgl04071  Sphingolipid signaling pathway
hgl04110  Cell cycle
hgl04115  p53 signaling pathway
hgl04137  Mitophagy - animal
hgl04151  PI3K-Akt signaling pathway
hgl04210  Apoptosis
hgl04211  Longevity regulating pathway
hgl04216  Ferroptosis
hgl04218  Cellular senescence
hgl04310  Wnt signaling pathway
hgl04722  Neurotrophin signaling pathway
hgl04919  Thyroid hormone signaling pathway
hgl05012  Parkinson disease
hgl05014  Amyotrophic lateral sclerosis
hgl05016  Huntington disease
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05165  Human papillomavirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05200  Pathways in cancer
hgl05202  Transcriptional misregulation in cancer
hgl05203  Viral carcinogenesis
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05216  Thyroid cancer
hgl05217  Basal cell carcinoma
hgl05218  Melanoma
hgl05219  Bladder cancer
hgl05220  Chronic myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05230  Central carbon metabolism in cancer
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101701769 (Tp53)
   04310 Wnt signaling pathway
    101701769 (Tp53)
   04071 Sphingolipid signaling pathway
    101701769 (Tp53)
   04151 PI3K-Akt signaling pathway
    101701769 (Tp53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101701769 (Tp53)
  09143 Cell growth and death
   04110 Cell cycle
    101701769 (Tp53)
   04210 Apoptosis
    101701769 (Tp53)
   04216 Ferroptosis
    101701769 (Tp53)
   04115 p53 signaling pathway
    101701769 (Tp53)
   04218 Cellular senescence
    101701769 (Tp53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101701769 (Tp53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101701769 (Tp53)
  09149 Aging
   04211 Longevity regulating pathway
    101701769 (Tp53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101701769 (Tp53)
   05202 Transcriptional misregulation in cancer
    101701769 (Tp53)
   05206 MicroRNAs in cancer
    101701769 (Tp53)
   05205 Proteoglycans in cancer
    101701769 (Tp53)
   05203 Viral carcinogenesis
    101701769 (Tp53)
   05230 Central carbon metabolism in cancer
    101701769 (Tp53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101701769 (Tp53)
   05212 Pancreatic cancer
    101701769 (Tp53)
   05225 Hepatocellular carcinoma
    101701769 (Tp53)
   05226 Gastric cancer
    101701769 (Tp53)
   05214 Glioma
    101701769 (Tp53)
   05216 Thyroid cancer
    101701769 (Tp53)
   05220 Chronic myeloid leukemia
    101701769 (Tp53)
   05217 Basal cell carcinoma
    101701769 (Tp53)
   05218 Melanoma
    101701769 (Tp53)
   05219 Bladder cancer
    101701769 (Tp53)
   05215 Prostate cancer
    101701769 (Tp53)
   05213 Endometrial cancer
    101701769 (Tp53)
   05224 Breast cancer
    101701769 (Tp53)
   05222 Small cell lung cancer
    101701769 (Tp53)
   05223 Non-small cell lung cancer
    101701769 (Tp53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101701769 (Tp53)
   05014 Amyotrophic lateral sclerosis
    101701769 (Tp53)
   05016 Huntington disease
    101701769 (Tp53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101701769 (Tp53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101701769 (Tp53)
   05161 Hepatitis B
    101701769 (Tp53)
   05160 Hepatitis C
    101701769 (Tp53)
   05162 Measles
    101701769 (Tp53)
   05168 Herpes simplex virus 1 infection
    101701769 (Tp53)
   05163 Human cytomegalovirus infection
    101701769 (Tp53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101701769 (Tp53)
   05169 Epstein-Barr virus infection
    101701769 (Tp53)
   05165 Human papillomavirus infection
    101701769 (Tp53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101701769 (Tp53)
   01522 Endocrine resistance
    101701769 (Tp53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hgl03000]
    101701769 (Tp53)
   03036 Chromosome and associated proteins [BR:hgl03036]
    101701769 (Tp53)
   03400 DNA repair and recombination proteins [BR:hgl03400]
    101701769 (Tp53)
Transcription factors [BR:hgl03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    101701769 (Tp53)
Chromosome and associated proteins [BR:hgl03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101701769 (Tp53)
DNA repair and recombination proteins [BR:hgl03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    101701769 (Tp53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD TAD2 DEC-1_N
Other DBs
NCBI-GeneID: 101701769
NCBI-ProteinID: NP_001297199
UniProt: G5B5D6
LinkDB
Position
Un
AA seq 391 aa
MEEPQSDLSIEPPLSQETFSDLWKLLPENNVLSSSLSSPMDDLLLSPEDVVNWLGGNPDE
DVQVSAAPVPEPPTPVAPAPAAPAPATSWPLSSSVPSHKTYQGNYGFHLGFLQSGTAKSV
TCTYSPVLNKLFCQLAKTCPVQVWVESPPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERC
SDSDGLAPPQHLIRVEGNLRAEYLDDRTTFRHSVVVPYDLPEVGSDCTTIHYNYMCNSSC
MGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFHKKGGSCPEPTPG
SIKRALPTGTNSSPQPKKKPLDGEYFTLKIRGRERFEMFRELNEALELKDAQTEKEPGES
RPHSSYLKSKKGQSTSCHKKLMFKKEGPDSD
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggaagagccacagtcggatctcagcatcgagcctccactgagtcaggagacattttca
gacttatggaaactacttcctgaaaacaacgttctgtccagctcactgtcctctcccatg
gatgatctgctgctgtccccagaagatgttgtaaactggctgggaggaaacccagatgaa
gatgtccaagtgtcagcagctcctgtaccagagcccccaacaccagtggcccctgccccg
gcagctcccgcaccagccacttcctggcctctgtcatcctccgtcccttcccataagacc
taccaaggcaactatggtttccatctgggcttccttcagtctgggacggccaaatctgtc
acatgcacgtactcccctgttctcaacaagttattctgccaactggcaaagacctgccct
gtgcaagtgtgggtcgaatcaccacccccacctggcacccgagtccgtgccatggccatc
tacaagaagtcacagcacatgacagaagttgtgaggcgctgcccccaccatgagcgctgc
tccgatagtgatggcctggcccctcctcagcatcttatccgggtggaaggaaatctgcgt
gcagaatatttggatgacagaaccacttttcgccatagcgtggtggtaccctatgatctg
cctgaggttggctctgactgtaccaccatccactacaactatatgtgcaacagttcttgc
atggggggcatgaaccgtaggcccatcctcaccattatcacactggaagactccagtggg
aacctgctggggcggaacagctttgaggtgcgtgtttgtgcctgtcctgggagagaccgg
cgcacagaggaagaaaatttccacaagaaaggggggtcatgcccagagccaacaccagga
agcattaagcgagcactgcccactggcaccaactcttctcctcagccaaagaagaaacca
ctggatggggaatatttcacccttaagatccgtgggcgtgaacgctttgagatgttccga
gagctaaatgaggccttggaactcaaggatgcccaaactgagaaggagccaggggagagc
aggcctcactcaagctacctgaagtctaagaaggggcagtctacctcctgtcataaaaaa
ctaatgttcaagaaagaaggacctgattcagactga

DBGET integrated database retrieval system