KEGG   Heterocephalus glaber (naked mole rat): 101702039
Entry
101702039         CDS       T02812                                 

Gene name
Fhl1
Definition
(RefSeq) four and a half LIM domains 1
  KO
K14365  four and a half LIM domains protein 1
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101702039 (Fhl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hgl04990]
    101702039 (Fhl1)
Domain-containing proteins not elsewhere classified [BR:hgl04990]
 LIM domain-containing proteins
  FHL family proteins
   101702039 (Fhl1)
SSDB
Motif
Pfam: LIM Ureidogly_lyase
Other DBs
NCBI-GeneID: 101702039
NCBI-ProteinID: XP_004862391
LinkDB
Position
Un
AA seq 339 aa
MASQRHSGPSSYKVGTMAEKSDCHYCRDSLQGKKYVQKDGHHCCLKCFDKFCANTCVECR
KPIGADSKEVHYKNRYWHDTCFRCAKCLHPLASETFVSKDNKILCNKCATREDSPRCKGC
FKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVK
CNKAITSGGITYQDQPWHADCFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGC
KNPITGKRTVPRVSHPVSKARKPPVCRGKRLPLTLFPSANLRGRHPGGERTCPSWVVVLC
RKNRSLAAPRGPGLVKAPVWWPMKDNPGTTTASTAKNAP
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcttctcaaagacattcaggtccctccagctataaggtgggcaccatggctgagaag
tcggactgccactactgcagggactctttgcaggggaagaagtacgtgcagaaggatggc
caccactgctgcctgaagtgctttgacaagttctgtgccaacacctgcgtggagtgccgc
aagcccatcggtgcagattccaaggaggtgcactacaagaaccgctactggcacgacacc
tgcttccgctgtgccaagtgccttcaccccttggccagcgagacctttgtgtccaaggac
aacaagatactgtgcaacaaatgtgccactcgggaggactcccccaggtgcaaagggtgc
ttcaaggccatcgtggcaggagaccagaacgtggagtacaagggcaccgtctggcacaaa
gactgcttcacctgcagcaactgcaagcaagtcatcgggaccggaagcttcttcccaaaa
ggggaggacttctactgcgtgacttgccacgagaccaagtttgccaagcactgcgtcaag
tgcaacaaggccatcacatctggaggaatcacttaccaggatcagccctggcatgccgat
tgctttgtgtgtgttacctgctctaagaagctggctgggcagcgtttcaccgctgtggag
gaccagtattactgcgtggattgctacaagaactttgtggccaagaagtgtgctggatgc
aagaaccccatcactgggaaaaggactgtgccaagagtgagccacccagtctctaaagct
aggaagcccccagtgtgccgcgggaaacgcttgcctctcaccctgtttcccagcgccaac
ctccggggcaggcatccgggtggagaaaggacttgtccctcatgggtggtggttctttgt
agaaaaaatcgaagcttagcagctcctcgaggcccgggtttggtaaaggctccagtgtgg
tggcctatgaaggacaatcctggcacgactactgcttccactgcaaaaaatgctccgtga

DBGET integrated database retrieval system