KEGG   Heterocephalus glaber (naked mole rat): 101702403
Entry
101702403         CDS       T02812                                 

Gene name
Vegfa
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  vascular endothelial growth factor A
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl04010  MAPK signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04020  Calcium signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04370  VEGF signaling pathway
hgl04510  Focal adhesion
hgl04926  Relaxin signaling pathway
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl05163  Human cytomegalovirus infection
hgl05165  Human papillomavirus infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05200  Pathways in cancer
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05211  Renal cell carcinoma
hgl05212  Pancreatic cancer
hgl05219  Bladder cancer
hgl05323  Rheumatoid arthritis
hgl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101702403 (Vegfa)
   04014 Ras signaling pathway
    101702403 (Vegfa)
   04015 Rap1 signaling pathway
    101702403 (Vegfa)
   04370 VEGF signaling pathway
    101702403 (Vegfa)
   04066 HIF-1 signaling pathway
    101702403 (Vegfa)
   04020 Calcium signaling pathway
    101702403 (Vegfa)
   04151 PI3K-Akt signaling pathway
    101702403 (Vegfa)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101702403 (Vegfa)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101702403 (Vegfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101702403 (Vegfa)
   05206 MicroRNAs in cancer
    101702403 (Vegfa)
   05205 Proteoglycans in cancer
    101702403 (Vegfa)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101702403 (Vegfa)
   05211 Renal cell carcinoma
    101702403 (Vegfa)
   05219 Bladder cancer
    101702403 (Vegfa)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101702403 (Vegfa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101702403 (Vegfa)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101702403 (Vegfa)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101702403 (Vegfa)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101702403 (Vegfa)
   05165 Human papillomavirus infection
    101702403 (Vegfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101702403 (Vegfa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101702403 (Vegfa)
   00536 Glycosaminoglycan binding proteins [BR:hgl00536]
    101702403 (Vegfa)
Cytokines and growth factors [BR:hgl04052]
 Growth factors
  Growth factors (RTK binding)
   101702403 (Vegfa)
Glycosaminoglycan binding proteins [BR:hgl00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101702403 (Vegfa)
SSDB
Motif
Pfam: PDGF VEGF_C
Other DBs
NCBI-GeneID: 101702403
NCBI-ProteinID: XP_012928209
LinkDB
Position
Un
AA seq 449 aa
NRADALGRSLLCSKLLRILESSREEREAARAPERSRGRASARRGLSEKRGARGAASDLLS
GDRRAQRAGRPPRGTPRDRPPTDGQADTAPGPAPTVCPSEPARGGGVEGVGARGTALKLF
AQLLGGSRPGGAVVRAGATDLSAAGERASTGREEPPPEQGEAEGEEAAEAERGPRRALGS
QGPGPWTGEAAECANSAPAARAPQAPAGRGSRRGAQESGPSRSPSRKASARRAGPGRASD
TMNFLLSWVHWSLALLLYLHHAKWSQAAPMVEGEQNPREVVKFMDVYKRSYCRPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDESLECVPTEEFNITMQIMRIKPHQGQHIGEM
SFLQHSRCECRPKRERARQEKKSVRGKGKGQKRKRKKSRPCGPCSERRKHLFVQDPQTCK
CSCRNTHSRCKARQLELNERTCRCDKPRR
NT seq 1350 nt   +upstreamnt  +downstreamnt
aatcgggccgacgctttggggagatcgctcctttgctccaaattacttcggattttggaa
agcagccgagaggagagagaggcggcgagagccccggagagaagtcgaggaagagcgagc
gcgcgccgcggcctcagcgagaagcgcggggcacggggcgcagccagtgacctgctttcg
ggtgaccgccgagcgcagcgtgcggggcgccctcctcgcgggactccccgggaccgcccg
cccacagacggacaggccgacaccgcgcctggcccggcgcccaccgtctgcccctcggag
cccgcacgcggaggcggcgtggagggggtcggggcgcgcggcactgcgctgaaacttttc
gcgcaacttctgggcggctctcgccccggaggagccgtggtccgcgccggggccaccgac
ctgagcgcagccggcgagagggcgagcacgggccgcgaagagccgccaccggagcagggg
gaggcggaaggcgaagaggcggcggaggcggagcgggggccgcggcgggcgctcggctct
caggggccgggcccatggacgggtgaggcggccgagtgcgcaaacagtgccccggccgcg
cgcgcgccccaggccccggcaggaagaggatcccgccgaggcgcgcaggagagcgggccg
tcccgcagcccgagccgcaaagcgagcgcgcgccgcgccggccccggccgggcctccgac
accatgaactttttgctctcctgggtgcactggagcctggccttgctgctctacctccac
catgccaagtggtcccaggcggcacccatggtggaaggagagcagaatccccgtgaagtg
gtgaagttcatggatgtctacaagcgtagctactgccgtccgatcgagacgctggtggac
atcttccaggagtaccctgatgagatcgagtacatcttcaagccatcctgtgtgcccctg
atgcggtgtgggggctgctgtaatgatgagagtctggagtgtgtgcccactgaggagttc
aacatcaccatgcagatcatgcggatcaaaccccaccaagggcagcacattggggagatg
agtttcctccagcacagcagatgtgaatgcagaccaaagagagaaagagcaaggcaagaa
aaaaaatcagttcgaggaaagggaaaggggcaaaaacgaaagcgcaagaaatcccgtccc
tgtgggccttgctcagagcggagaaagcatttgtttgtacaagatccgcagacgtgtaaa
tgctcctgcagaaacacacactcgcgttgcaaggcgaggcagcttgagttaaacgaacgt
acctgcagatgtgacaagccgaggcggtga

DBGET integrated database retrieval system