KEGG   Heterocephalus glaber (naked mole rat): 101702520Help
Entry
101702520         CDS       T02812                                 

Definition
(RefSeq) odorant-binding protein
Organism
hgl  Heterocephalus glaber (naked mole rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin Myco_arth_vir_N DUF3539
Motif
Other DBs
NCBI-GeneID: 101702520
NCBI-ProteinID: XP_004867439
LinkDB All DBs
Position
Un
AA seq 217 aa AA seqDB search
MEQRYKTDGSSDSLQHLSSSNLPLEKKRHSNKMKILTLALAVGLACASQHLDPVKINGDW
RSIYIAADKAEKIEEGGELRAYFRHIECQDECRNLSIRFFVKLDRVCQEFTVVGVKDEKS
GVYITDYAGKNYFTVVESTEYITQFSDMNVDEKGTKTNAVLIAAKRDSLTEEEKQKFVQL
AEEKGIPTENIRNVIATDDNVTGVFAIFSKTTESFMC
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcgctataaaacagacggcagctccgactcccttcagcatctctcctcctcc
aatcttccgctggagaagaaacgccactccaacaagatgaagattctcacgctcgctctg
gcagtcggtctggcttgtgccagtcaacacctggaccctgtcaagatcaacggtgactgg
cgcagcatttacatagcggctgataaggcagagaagatcgaagaggggggtgaactgaga
gcctatttccgccacatagaatgtcaagacgaatgcagaaatctctctatcaggtttttt
gtcaagttggacagagtgtgccaagagttcactgtagtgggagtaaaggatgaaaaaagt
ggtgtttacatcaccgactatgctggtaaaaactatttcacagttgttgaaagcacagaa
tatatcacacaatttagtgacatgaacgtagatgaaaaaggcacaaaaacgaatgcggtt
ttaattgctgcaaaaagggacagcctgacggaggaagaaaagcagaagtttgtccagttg
gctgaggagaagggaattccgactgaaaacatcagaaatgtcatcgcaacagatgataac
gtgacaggagtatttgcaatcttctcaaagacaactgaatcattcatgtgctga

DBGET integrated database retrieval system