KEGG   Heterocephalus glaber (naked mole rat): 101702608
Entry
101702608         CDS       T02812                                 

Gene name
Cdk4
Definition
(RefSeq) cyclin dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01522  Endocrine resistance
hgl04110  Cell cycle
hgl04115  p53 signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04218  Cellular senescence
hgl04530  Tight junction
hgl04660  T cell receptor signaling pathway
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04934  Cushing syndrome
hgl05160  Hepatitis C
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05166  Human T-cell leukemia virus 1 infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05169  Epstein-Barr virus infection
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
hgl05212  Pancreatic cancer
hgl05214  Glioma
hgl05218  Melanoma
hgl05219  Bladder cancer
hgl05220  Chronic myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101702608 (Cdk4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101702608 (Cdk4)
   04115 p53 signaling pathway
    101702608 (Cdk4)
   04218 Cellular senescence
    101702608 (Cdk4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101702608 (Cdk4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101702608 (Cdk4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101702608 (Cdk4)
   05203 Viral carcinogenesis
    101702608 (Cdk4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101702608 (Cdk4)
   05225 Hepatocellular carcinoma
    101702608 (Cdk4)
   05214 Glioma
    101702608 (Cdk4)
   05220 Chronic myeloid leukemia
    101702608 (Cdk4)
   05218 Melanoma
    101702608 (Cdk4)
   05219 Bladder cancer
    101702608 (Cdk4)
   05224 Breast cancer
    101702608 (Cdk4)
   05222 Small cell lung cancer
    101702608 (Cdk4)
   05223 Non-small cell lung cancer
    101702608 (Cdk4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101702608 (Cdk4)
   04934 Cushing syndrome
    101702608 (Cdk4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101702608 (Cdk4)
   05160 Hepatitis C
    101702608 (Cdk4)
   05164 Influenza A
    101702608 (Cdk4)
   05162 Measles
    101702608 (Cdk4)
   05163 Human cytomegalovirus infection
    101702608 (Cdk4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101702608 (Cdk4)
   05169 Epstein-Barr virus infection
    101702608 (Cdk4)
   05165 Human papillomavirus infection
    101702608 (Cdk4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101702608 (Cdk4)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101702608 (Cdk4)
Protein kinases [BR:hgl01001]
 Serine/threonine kinases: CMGC group
  CDK family
   101702608 (Cdk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 101702608
NCBI-ProteinID: XP_004861233
LinkDB
Position
Un
AA seq 293 aa
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPSGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCTFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSVVPEMEESGTQLLLEMLTFNPHKLISLPSSAAAA
NT seq 882 nt   +upstreamnt  +downstreamnt
atggctacctctcgatatgagccagtggctgaaattggtgtgggtgcctatgggaccgtg
tacaaggcccgtgatccccatagtggccacttcgtggccctcaagagtgtgagagtcccc
agtggaggaggagctggaggaggcctacccatcagcacagtacgtgaggtggccttacta
aggcggctggaggcgttcgagcatcccaatgttgtccgcctgatggatgtctgtgccact
tcccgaactgaccgggagatcaaggtgaccctagtgtttgagcacgtagatcaagaccta
aggacgtatctggacaaggcacctccaccaggcttgccagttgaaactatcaaggatctg
atgcgccagtttctaagaggcctagatttccttcatgccaactgcatcgttcaccgagac
ctgaaaccagagaacattttggtgacaagtggtgggacagtcaagctggctgactttggc
ctagccagaatctacagctaccagatggcccttacaccagtggtagttacactctggtac
cgggctcctgaagttcttctgcagtctacatatgcaacacctgtggacatgtggagtgtt
ggctgtacctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct
gaccagttgggcaaaatctttgacctcattgggctgcctccagaggatgactggcctcga
gatgtatctttaccccgaggagccttttcccccagagggcctcgcccagtgcagtcagtg
gtacctgagatggaggagtctggaacacagctgctgctggaaatgctgacatttaacccc
cacaagctgatctccctcccgagctctgcagcagctgcataa

KEGG   Heterocephalus glaber (naked mole rat): 101719908
Entry
101719908         CDS       T02812                                 

Gene name
Cdk6
Definition
(RefSeq) cyclin dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04110  Cell cycle
hgl04115  p53 signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04218  Cellular senescence
hgl04934  Cushing syndrome
hgl05160  Hepatitis C
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05169  Epstein-Barr virus infection
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
hgl05206  MicroRNAs in cancer
hgl05212  Pancreatic cancer
hgl05214  Glioma
hgl05218  Melanoma
hgl05220  Chronic myeloid leukemia
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101719908 (Cdk6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101719908 (Cdk6)
   04115 p53 signaling pathway
    101719908 (Cdk6)
   04218 Cellular senescence
    101719908 (Cdk6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101719908 (Cdk6)
   05206 MicroRNAs in cancer
    101719908 (Cdk6)
   05203 Viral carcinogenesis
    101719908 (Cdk6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101719908 (Cdk6)
   05225 Hepatocellular carcinoma
    101719908 (Cdk6)
   05214 Glioma
    101719908 (Cdk6)
   05220 Chronic myeloid leukemia
    101719908 (Cdk6)
   05218 Melanoma
    101719908 (Cdk6)
   05224 Breast cancer
    101719908 (Cdk6)
   05222 Small cell lung cancer
    101719908 (Cdk6)
   05223 Non-small cell lung cancer
    101719908 (Cdk6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101719908 (Cdk6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101719908 (Cdk6)
   05164 Influenza A
    101719908 (Cdk6)
   05162 Measles
    101719908 (Cdk6)
   05163 Human cytomegalovirus infection
    101719908 (Cdk6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101719908 (Cdk6)
   05169 Epstein-Barr virus infection
    101719908 (Cdk6)
   05165 Human papillomavirus infection
    101719908 (Cdk6)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101719908 (Cdk6)
Protein kinases [BR:hgl01001]
 Serine/threonine kinases: CMGC group
  CDK family
   101719908 (Cdk6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2
Other DBs
NCBI-GeneID: 101719908
NCBI-ProteinID: XP_004862420
UniProt: G5C9J5
LinkDB
Position
Un
AA seq 326 aa
MEKDGLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKPAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
QDLERCKENLDSHLPSSQNASELNTA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagaaggacggcctgagccgcgccgaccagcagtacgagtgcgtggcggagatcggg
gagggcgcctatgggaaggtgttcaaggcccgcgacctgaaaaacggaggccggtttgtg
gcactgaagcgcgtgcgggtgcagaccggcgaggagggcatgccgctctccactatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt
gatgtgtgcacagtgtcacggacagacagggaaaccaaactaacactagtatttgaacat
gttgatcaagacctgaccacttacttggacaaagttcccgagcctggagtgcctactgaa
accataaaggatatgatgtttcagcttcttcgaggtctggacttccttcattctcaccga
gtggtgcatcgtgatctaaaaccacagaatattctggtgaccagcagtggacaaataaag
cttgctgactttggccttgcccgcatctatagttttcagatggctcttacttcagtggtt
gtcacattgtggtaccgtgctcctgaagtcttgctccagtccagctacgccacccccgtg
gatctctggagtgttggctgcatatttgcagaaatgtttcgtagaaagcctctttttcgt
ggaagttcagatgtggatcaactaggaaaaatcttggatgtaattggactcccaggagaa
gaggactggcctagagatgtggcccttcccaggcaggcttttcattccaaacctgcccaa
cccattgagaagtttgtaacagatattgacgagctaggcaaagacctacttctgaagtgc
ttgacatttaatccagccaagagaatatctgcctacagtgccctgtctcacccatacttc
caagacctggagaggtgcaaggagaacctggattcccacctgccatccagccagaatgcc
tcagagctgaacacagcctga

DBGET integrated database retrieval system