KEGG   Heterocephalus glaber (naked mole rat): 101702710Help
Entry
101702710         CDS       T02812                                 

Gene name
Ezh2
Definition
(RefSeq) enhancer of zeste 2 polycomb repressive complex 2 subunit
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00310  Lysine degradation
hgl05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101702710 (Ezh2)
 09160 Human Diseases
  09161 Cancers
   05206 MicroRNAs in cancer
    101702710 (Ezh2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hgl03036]
    101702710 (Ezh2)
Enzymes [BR:hgl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101702710 (Ezh2)
Chromosome and associated proteins [BR:hgl03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101702710 (Ezh2)
   Polycomb group proteins
    PRC2-EZH2 complex
     101702710 (Ezh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET EZH2_WD-Binding
Motif
Other DBs
NCBI-GeneID: 101702710
NCBI-ProteinID: XP_004860526
LinkDB All DBs
Position
Un
AA seq 751 aa AA seqDB search
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEW
KQRRIQPVHIMTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNF
MVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQ
YNDDDDDDDGDDPDEGEEKQKDLEDSRDDKESHPPRKFPSDKIFEAISSMFPDKGTAEEL
KEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHRKC
NYSFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRR
GRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQ
TPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESS
IIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCP
CVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWD
SKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRG
KVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRA
IQTGEELFFDYRYSQADALKYVGIEREMEIP
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgggccagacggggaagaaatctgagaagggacctgtttgttggaggaagcgtgtaaaa
tcagagtacatgcgactgagacagctcaagaggttcagacgagctgatgaagtaaagagt
atgtttagttctaatcgtcaaaaaattttggaaagaacggaaatcttaaaccaagaatgg
aaacagcgaaggatacagcccgtgcacatcatgacttctgtgagctcattgcgagggact
agggagtgttcggtgaccagtgacttggattttccaacacaagtcatcccgttaaagacc
ctaaatgcagttgcctcagtacccataatgtattcttggtctcccctccagcagaatttt
atggtagaagatgaaactgttttacataacattccttacatgggggatgaagtcctagac
caggatggcacttttattgaagaactaataaaaaattatgacggcaaagtccatggagat
cgagagtgtgggtttataaacgatgaaatttttgtggagttagtgaatgctctcggtcaa
tacaatgatgatgacgacgacgatgatggagatgatcccgatgaaggagaggagaagcag
aaggatctagaggatagtcgagatgataaagaaagccacccaccacggaaatttccttct
gataaaatttttgaagccatttcttcaatgtttccagataaaggcacagcagaagaacta
aaggaaaaatacaaagaactcaccgagcagcagctcccaggtgcacttcctcctgaatgt
actcccaacatagatggaccaaatgctaagtctgtgcagagggagcagagcttacattca
tttcatacgcttttctgtcggcgatgttttaagtatgactgcttcctacatcgtaagtgc
aattattcttttcatgcaacacccaacacatacaagcggaaaaacacagaaacagctctg
gacaacaagccttgtggacctcagtgttaccagcacctggagggagcgaaggagtttgct
gctgccctcacagctgagcggataaagacaccgcccaagcgccctgggggccgaaggcga
ggccggctccccaacaacagcagcaggcccagcacccctaccatcaatgtgctggagtca
aaggacaccgacagcgacagagaagcagggactgaaactgggggagaaaataacgataaa
gaagaagaagagaaaaaggatgaaacttcgagctcctctgaagcaaattctcggtgtcaa
accccaataaagatgaagccaaatatcgaacctcctgagaatgtggagtggagtggtgcc
gaagcctcgatgttcagggtcctcatcggcacttactatgataatttctgtgctatcgcc
aggttgattgggaccaaaacatgcaggcaggtgtatgagtttagagtcaaagaatcgagc
atcatagcacctgctcctgcggaggacgtggacactcctccacgaaagaagaagaggaaa
caccggttgtgggctgcacactgcagaaagatacaactgaaaaaggatggctcctctaac
catgtttacaactatcaaccctgtgaccatccacggcagccttgtgacagttcatgccct
tgtgtgatagcacaaaatttttgtgaaaagttttgtcaatgtagttcagagtgtcagaac
cgctttcctggatgccgctgcaaagcacagtgcaacaccaagcagtgcccatgctacctg
gctgtccgagagtgtgacccagacctctgcctgacatgcggagctgcagaccactgggac
agcaagaacgtgtcctgcaagaattgtagcatccagaggggctccaaaaagcatttactg
ctggcaccatcggatgtagcaggctgggggattttcatcaaagatcctgtgcaaaaaaat
gaattcatctcggaatactgtggagagattatttctcaagatgaagcagacagaagaggc
aaagtgtatgataaatacatgtgcagcttcctgttcaacttgaacaacgattttgtggtg
gatgcaactcgcaagggcaacaaaattcgttttgcaaatcactcagtaaatccaaattgc
tatgcaaaagtcatgatggtgaatggcgaccacaggatcggcatctttgcaaagagggcc
atccagaccggtgaagagctgttcttcgattacagatacagccaggctgacgccctgaag
tatgtgggcattgagcgagagatggaaatcccttga

DBGET integrated database retrieval system