KEGG   Heterocephalus glaber (naked mole rat): 101702898
Entry
101702898         CDS       T02812                                 

Gene name
Casp9
Definition
(RefSeq) caspase 9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01524  Platinum drug resistance
hgl04115  p53 signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04210  Apoptosis
hgl04215  Apoptosis - multiple species
hgl04370  VEGF signaling pathway
hgl04919  Thyroid hormone signaling pathway
hgl05010  Alzheimer disease
hgl05012  Parkinson disease
hgl05014  Amyotrophic lateral sclerosis
hgl05016  Huntington disease
hgl05020  Prion disease
hgl05022  Pathways of neurodegeneration - multiple diseases
hgl05134  Legionellosis
hgl05145  Toxoplasmosis
hgl05152  Tuberculosis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05169  Epstein-Barr virus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05200  Pathways in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05215  Prostate cancer
hgl05222  Small cell lung cancer
hgl05223  Non-small cell lung cancer
hgl05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101702898 (Casp9)
   04151 PI3K-Akt signaling pathway
    101702898 (Casp9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101702898 (Casp9)
   04215 Apoptosis - multiple species
    101702898 (Casp9)
   04115 p53 signaling pathway
    101702898 (Casp9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101702898 (Casp9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101702898 (Casp9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101702898 (Casp9)
   05212 Pancreatic cancer
    101702898 (Casp9)
   05215 Prostate cancer
    101702898 (Casp9)
   05213 Endometrial cancer
    101702898 (Casp9)
   05222 Small cell lung cancer
    101702898 (Casp9)
   05223 Non-small cell lung cancer
    101702898 (Casp9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101702898 (Casp9)
   05012 Parkinson disease
    101702898 (Casp9)
   05014 Amyotrophic lateral sclerosis
    101702898 (Casp9)
   05016 Huntington disease
    101702898 (Casp9)
   05020 Prion disease
    101702898 (Casp9)
   05022 Pathways of neurodegeneration - multiple diseases
    101702898 (Casp9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101702898 (Casp9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    101702898 (Casp9)
   05152 Tuberculosis
    101702898 (Casp9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101702898 (Casp9)
   05161 Hepatitis B
    101702898 (Casp9)
   05160 Hepatitis C
    101702898 (Casp9)
   05164 Influenza A
    101702898 (Casp9)
   05162 Measles
    101702898 (Casp9)
   05168 Herpes simplex virus 1 infection
    101702898 (Casp9)
   05163 Human cytomegalovirus infection
    101702898 (Casp9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101702898 (Casp9)
   05169 Epstein-Barr virus infection
    101702898 (Casp9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101702898 (Casp9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101702898 (Casp9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hgl01009]
    101702898 (Casp9)
   01002 Peptidases and inhibitors [BR:hgl01002]
    101702898 (Casp9)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     101702898 (Casp9)
Protein phosphatases and associated proteins [BR:hgl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101702898 (Casp9)
Peptidases and inhibitors [BR:hgl01002]
 Cysteine peptidases
  Family C14: caspase family
   101702898 (Casp9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 101702898
NCBI-ProteinID: XP_004850381
UniProt: A0A0N8ESW5
LinkDB
Position
Un
AA seq 453 aa
MDEEHRQLLRRCRVRLVGDLQVASLWDALLNRELFTPDMIEDIQRAGSGSRRDQARQLIT
DLETRGRQALPLFISCLEDTGQDTLASFLRTSWQATKRDPEAIRPLDLEPMVVGPMGLKP
EKLQVMKPDPSNLAPGNVTPVVLGPEELAPAQLRPEVLRPEAPRPVDIGSGGFSDVRAQE
RLKGNTHLAYVLNADPCGHCLIINNVNFCPASGLSSRTGSNIDCVKMQHRFSRLHFQVEV
RGDLTAKEMVWTLVELARRDHHALDCCVVVVLSHGCQASHLQFPGAVYGTDGCPVSVEKI
VNIFSGTSCPTLGGKPKLFFIQACGGEQKDHGFEVARTSPNDEAPGSSPESDAVPFQAGP
RPRDQTDALSSLPTPSDILVSYSTFPGFVSWRDTSRGSWYIETLDGVLERWAPSEDLQYL
LLRVANAVSEKGIYKQIPGCFNFLRKKLFFRTE
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggacgaagagcatcggcagctcctgcggcgttgccgcgtgcgcctggtgggtgacctg
caggtggcctcgctgtgggacgctctgctgaatcgcgagctcttcacccccgacatgatc
gaggacatccagcgggcaggctctggatctcggcgggaccaggccaggcagctgatcaca
gatcttgagacccgagggaggcaggcccttcctttgttcatctcctgtttagaggacaca
ggccaggacacattggcttcattcttgcgcacaagttggcaagcaacaaagagggatcca
gaggccatcagacccctggaccttgagcctatggtggtgggaccaatggggctcaaacca
gagaagctgcaagtgatgaagccggatccttcaaacctggccccaggaaatgtcactcca
gtggtgctggggccggaggagcttgcaccagctcagctcaggccagaggttctcagacca
gaagcacccagaccagtggacattggctctggaggattcagtgatgtccgtgctcaggag
aggctgaagggaaatacacatttggcatatgtcctgaacgcggacccttgtggccactgc
ctcatcatcaacaacgtgaacttctgcccagcgtcggggctcagctctcgcactggctcc
aacatcgactgtgtgaagatgcagcaccgcttctcccggctgcatttccaggtggaggtt
aggggtgacctgactgccaaggaaatggtctggactttggtggagctggcacgacgggac
caccacgctctggactgctgcgtggtggttgtcctctctcatggctgtcaggccagccac
ctccagttcccaggtgctgtctacggtacagatggatgtcctgtgtctgtcgagaaaatc
gtgaacatcttcagtgggaccagctgccccaccctaggagggaagcccaagctctttttc
atccaagcctgtggtggggaacagaaagaccatgggtttgaagtggcccgcacttccccc
aacgacgaggcccctggcagcagccctgagtcagatgctgtcccattccaggcaggcccg
aggccccgggatcagactgacgccctgtcgagtttgcccacacccagtgacatcctcgtg
tcctactccaccttcccaggtttcgtctcctggagggacacctcacgcggctcctggtac
attgagaccctggacggcgtcttggagcgctgggctccctcggaagacctgcagtacctg
ctgctcagggttgctaatgctgtgtctgagaaagggatttacaaacagattcctggttgc
tttaatttcctccggaaaaaacttttctttagaaccgaatga

DBGET integrated database retrieval system