KEGG   Heterocephalus glaber (naked mole rat): 101702911
Entry
101702911         CDS       T02812                                 

Gene name
Rps6kb2
Definition
(RefSeq) ribosomal protein S6 kinase B2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl04012  ErbB signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04140  Autophagy - animal
hgl04150  mTOR signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04152  AMPK signaling pathway
hgl04211  Longevity regulating pathway
hgl04213  Longevity regulating pathway - multiple species
hgl04350  TGF-beta signaling pathway
hgl04371  Apelin signaling pathway
hgl04666  Fc gamma R-mediated phagocytosis
hgl04714  Thermogenesis
hgl04910  Insulin signaling pathway
hgl04931  Insulin resistance
hgl05163  Human cytomegalovirus infection
hgl05165  Human papillomavirus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05200  Pathways in cancer
hgl05205  Proteoglycans in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05221  Acute myeloid leukemia
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05231  Choline metabolism in cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101702911 (Rps6kb2)
   04350 TGF-beta signaling pathway
    101702911 (Rps6kb2)
   04371 Apelin signaling pathway
    101702911 (Rps6kb2)
   04066 HIF-1 signaling pathway
    101702911 (Rps6kb2)
   04151 PI3K-Akt signaling pathway
    101702911 (Rps6kb2)
   04152 AMPK signaling pathway
    101702911 (Rps6kb2)
   04150 mTOR signaling pathway
    101702911 (Rps6kb2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101702911 (Rps6kb2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101702911 (Rps6kb2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101702911 (Rps6kb2)
  09149 Aging
   04211 Longevity regulating pathway
    101702911 (Rps6kb2)
   04213 Longevity regulating pathway - multiple species
    101702911 (Rps6kb2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101702911 (Rps6kb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101702911 (Rps6kb2)
   05205 Proteoglycans in cancer
    101702911 (Rps6kb2)
   05231 Choline metabolism in cancer
    101702911 (Rps6kb2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101702911 (Rps6kb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101702911 (Rps6kb2)
   05212 Pancreatic cancer
    101702911 (Rps6kb2)
   05225 Hepatocellular carcinoma
    101702911 (Rps6kb2)
   05226 Gastric cancer
    101702911 (Rps6kb2)
   05221 Acute myeloid leukemia
    101702911 (Rps6kb2)
   05224 Breast cancer
    101702911 (Rps6kb2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101702911 (Rps6kb2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101702911 (Rps6kb2)
   05163 Human cytomegalovirus infection
    101702911 (Rps6kb2)
   05165 Human papillomavirus infection
    101702911 (Rps6kb2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101702911 (Rps6kb2)
   01522 Endocrine resistance
    101702911 (Rps6kb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101702911 (Rps6kb2)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101702911 (Rps6kb2)
Protein kinases [BR:hgl01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   101702911 (Rps6kb2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal FTA2 Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 101702911
NCBI-ProteinID: XP_004852295
LinkDB
Position
Un
AA seq 478 aa
MAAVFDLDLETEEGSEGEPEFSPAEVCPLAELRAAGLEPVGHYEEVELTENSVNPRLERI
GPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIICNAKDTAHTQAERNI
LESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLAL
GHLHSQGIIYRDLKPENIMLNSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEILV
RSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIKGKLVLPPYLTPDARDLVKK
FLKRNPSQRIGGGPGDAADVQRHPFFRHFNWDDLLARRVDPPFRPSLQSEEDVSQFDTHF
TRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRTPI
SPLKFSPFEGLRPSPGPPEPMEPPLPPPPPLPSSTAPLPIRPPSGTKKSKKGRGHPGH
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggcagccgtgtttgatctggacttggagacagaagaaggcagcgagggcgagccagag
ttcagcccagcggaggtgtgtcctcttgccgagttgagggctgctggcctggagcctgtg
ggacactatgaggaggtggagctgactgagaacagcgtgaacccacgcctggagcgcatc
gggccccactgctttgaattgctgagagtactgggcaaagggggctatgggaaggtgttc
caggtgcgaaaggtgcaaggcactaacttggggaaaatatatgccatgaaagtcctgagg
aaggccaaaatcatttgtaatgccaaggacacagcacatacccaggctgaacggaacatt
ctagagtcagtgaagcatcccttcattgtagaactggcctatgccttccagacaggtggc
aaactctacctcatcctggagtgcctcagtggtggtgagctcttcacacatctggagcga
gaaggcatcttcctggaagacacagcctgcttctacctagctgagatcaccctggctctg
ggccatctccattcccaaggcatcatttaccgagacctcaagcctgagaacatcatgctc
aacagccagggccacatcaaactgacagactttggactgtgcaaggaatccattcatgag
ggcgctgtcactcacaccttctgtggcaccattgagtacatggcccccgagattctggtg
cgcagtggccacaaccgagcagtggactggtggagcctgggggccctgatgtatgacatg
ctcactggatcgccacccttcactgcagagaacaggaagaagaccatggacaagatcatc
aaggggaagctggtgctgcccccctacctcaccccagatgcccgggaccttgtcaaaaag
tttctgaagcggaatcccagccaacggattgggggtggcccaggggatgctgctgatgtg
cagaggcaccccttcttccggcacttcaattgggatgatctcctggcccgccgtgtggac
ccccctttcaggccgagtctgcagtcagaggaggatgtgagtcagtttgacacccacttc
acacggcagacaccggtggacagcccagatgacacggccctcagtgagagtgccaatcag
gccttcctgggcttcacatatgtggccccttccgtcctggacagcatcaaagagggcttc
tccttccagcccaagttgcgctccccacgtcgcctcaacagcagcccccggaccccaatc
agccccctcaagttctctccctttgagggattgcgacccagcccaggcccaccagaaccc
atggaaccacctctgccaccaccaccaccactgccctcaagcactgctcccctccccatc
cgtcccccctcagggaccaagaagtccaagaagggccgtgggcaccctgggcactag

KEGG   Heterocephalus glaber (naked mole rat): 101724077
Entry
101724077         CDS       T02812                                 

Gene name
Rps6kb1
Definition
(RefSeq) ribosomal protein S6 kinase B1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl04012  ErbB signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04140  Autophagy - animal
hgl04150  mTOR signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04152  AMPK signaling pathway
hgl04211  Longevity regulating pathway
hgl04213  Longevity regulating pathway - multiple species
hgl04350  TGF-beta signaling pathway
hgl04371  Apelin signaling pathway
hgl04666  Fc gamma R-mediated phagocytosis
hgl04714  Thermogenesis
hgl04910  Insulin signaling pathway
hgl04931  Insulin resistance
hgl05163  Human cytomegalovirus infection
hgl05165  Human papillomavirus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05200  Pathways in cancer
hgl05205  Proteoglycans in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05221  Acute myeloid leukemia
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05231  Choline metabolism in cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101724077 (Rps6kb1)
   04350 TGF-beta signaling pathway
    101724077 (Rps6kb1)
   04371 Apelin signaling pathway
    101724077 (Rps6kb1)
   04066 HIF-1 signaling pathway
    101724077 (Rps6kb1)
   04151 PI3K-Akt signaling pathway
    101724077 (Rps6kb1)
   04152 AMPK signaling pathway
    101724077 (Rps6kb1)
   04150 mTOR signaling pathway
    101724077 (Rps6kb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101724077 (Rps6kb1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101724077 (Rps6kb1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101724077 (Rps6kb1)
  09149 Aging
   04211 Longevity regulating pathway
    101724077 (Rps6kb1)
   04213 Longevity regulating pathway - multiple species
    101724077 (Rps6kb1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101724077 (Rps6kb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101724077 (Rps6kb1)
   05205 Proteoglycans in cancer
    101724077 (Rps6kb1)
   05231 Choline metabolism in cancer
    101724077 (Rps6kb1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101724077 (Rps6kb1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101724077 (Rps6kb1)
   05212 Pancreatic cancer
    101724077 (Rps6kb1)
   05225 Hepatocellular carcinoma
    101724077 (Rps6kb1)
   05226 Gastric cancer
    101724077 (Rps6kb1)
   05221 Acute myeloid leukemia
    101724077 (Rps6kb1)
   05224 Breast cancer
    101724077 (Rps6kb1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101724077 (Rps6kb1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101724077 (Rps6kb1)
   05163 Human cytomegalovirus infection
    101724077 (Rps6kb1)
   05165 Human papillomavirus infection
    101724077 (Rps6kb1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101724077 (Rps6kb1)
   01522 Endocrine resistance
    101724077 (Rps6kb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101724077 (Rps6kb1)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101724077 (Rps6kb1)
Protein kinases [BR:hgl01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   101724077 (Rps6kb1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 101724077
NCBI-ProteinID: XP_004870428
UniProt: G5C898
LinkDB
Position
Un
AA seq 525 aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEEELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttacccagcgcctgacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggacgcaggctct
gaggaggagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatacgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtgcgaaaagtaacaggagcaaatactgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcattgtggatttaatttat
gcctttcagaccggtggaaaactctacctcatccttgagtatctcagtggaggagaacta
tttatgcagttagaaagagaggggatatttatggaagatacagcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaagggatcatctacagagacctgaag
ccggagaacatcatgcttaatcaccaaggtcacgtgaaactaacagactttggactatgc
aaagaatctattcatgatggaacagtcacacatacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacctccattcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaagcttaacttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctgaaaagaaacgctgcttctcgtcttggagctggtccc
ggggacgctggagaagttcaagctcatccattcttcagacacattaactgggaagaactt
ctggctcggaaggtggaacccccctttaaacctctgttgcaatctgaagaggatgtgagt
cagtttgattcaaagtttacacgtcagacacctgtcgatagcccagatgactcaactctc
agtgaaagtgccaaccaggtctttctgggttttacatatgtggctccatctgtacttgaa
agtgtaaaagaaaagttttcatttgaaccaaaaatccgatcaccacgaagatttattggc
agcccacgaacacctgtcagcccagtcaaattttctcctggggatttctggggaagaggt
gcttcagccagcacagcaaatccccagacgcctgtggaatacccaatggaaacaagtgga
atagagcagatggatgtgaccatgagtggggaagcatcagcaccacttccaatacggcag
ccgaactctgggccatacaaaaaacaagcttttcccatgatctccaaacggccagagcac
ctgcgtatgaatctatga

DBGET integrated database retrieval system