KEGG   Heterocephalus glaber (naked mole rat): 101703084
Entry
101703084         CDS       T02812                                 

Gene name
Socs5
Definition
(RefSeq) suppressor of cytokine signaling 5
  KO
K04698  suppressor of cytokine signaling 5
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04630  JAK-STAT signaling pathway
hgl04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101703084 (Socs5)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101703084 (Socs5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hgl04121]
    101703084 (Socs5)
Ubiquitin system [BR:hgl04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     101703084 (Socs5)
SSDB
Motif
Pfam: SOCS SOCS_box SH2
Other DBs
NCBI-GeneID: 101703084
NCBI-ProteinID: XP_004839456
UniProt: A0A0P6JWP7
LinkDB
Position
Un
AA seq 536 aa
MDKVGKMWNTFKYKCQNLFGHEGGSHSENVDMNSNRCLPIKEKKISLVDSAPQQQSSPLR
ENVALQLGLSPSKNSSRRNQNCATEIPQIVEISIEKDNDSCVTPGTRLTRRDSYSRHAPW
GGKKKHSCSTKTQSSLDTDKKFGRARSGLQRRERRYGVSSVHDMDSVSSRTIGSRSLRQR
LQDTVGLCFPMRTYTKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEMSGDSSAVPQGTCDSEEDTTTLCLQSRRQKQRQVSGDSHAHISRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggataaagtggggaaaatgtggaataccttcaaatacaaatgtcagaatcttttcggt
catgagggaggaagccatagtgaaaatgtggacatgaactccaacaggtgtttgcctatc
aaagagaaaaagatcagtctggtagactctgctcctcagcagcaaagcagtcccttaaga
gaaaatgttgccttacagctgggattaagtccttcaaagaattcttcaaggagaaaccaa
aactgtgctactgaaatccctcaaattgttgaaataagcatcgagaaagataatgattca
tgtgtcaccccaggaacaagactcacacgaagagattcctactctcgacatgccccatgg
ggtgggaagaaaaagcattcctgttccacaaagacccagagttctttggacactgataaa
aagtttggtagagctcgaagtggactgcaaaggcgagagaggcgctatggagtgagctca
gtgcacgacatggacagtgtttccagcagaaccattgggagccgctctctgagacagagg
ctacaggacaccgtgggcttgtgttttcccatgagaacttacaccaagcagtcaaagccc
ctcttttccaataaaagaaaaatacatctttctgaattgatgcttgagaaatgccctttt
cctgctggctcagatttagcccaaaaatggcatttgattaaacagcatacagctcctgtg
agcccacattcaaccttttttgatacatttgatccgtccttggtttctacagaagatgaa
gaagacagacttagagagagaagacggcttagtattgaagaaggggtggatccccctccc
aatgcacaaatacatacatttgaagctactgcacaggttaatcccttatataaactggga
ccaaagttagctcctggaatgacagaaatgagtggggacagttctgcagttccacagggt
acttgtgactcagaagaggacacaaccaccctgtgtttgcagtcacggaggcagaagcag
cgccaggtgtctggagacagccatgctcacattagcagacagggagcttggaaagtccat
acacagattgattatatacactgccttgtgccggatttacttcagattacagggaatccc
tgttactggggagtgatggatcggtatgaagcagaagcccttctggaagggaaacctgaa
ggcacatttttgctcagggactctgcacaagaggactacctcttctctgtgagcttccgc
cgctacaacagatccctgcatgcccgaattgaacagtggaatcacaacttcagttttgat
gcccacgacccgtgtgtgtttcactcttctactgtaacaggacttctagaacattataaa
gaccccagttcttgcatgttttttgaaccattgcttactatatctctgaataggaccttt
ccttttagcctgcagtacatctgccgtgcagtcatctgcaggtgcactacgtatgatgga
attgatgggctccctctaccgtcaatgttacaggattttttaaaggagtatcattataaa
caaaaggttagggttcgctggttagaacgagaaccagtcaaggcaaagtaa

KEGG   Heterocephalus glaber (naked mole rat): 101704157
Entry
101704157         CDS       T02812                                 

Gene name
Socs3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04120  Ubiquitin mediated proteolysis
hgl04380  Osteoclast differentiation
hgl04630  JAK-STAT signaling pathway
hgl04668  TNF signaling pathway
hgl04910  Insulin signaling pathway
hgl04917  Prolactin signaling pathway
hgl04920  Adipocytokine signaling pathway
hgl04930  Type II diabetes mellitus
hgl04931  Insulin resistance
hgl04932  Non-alcoholic fatty liver disease
hgl04935  Growth hormone synthesis, secretion and action
hgl05160  Hepatitis C
hgl05164  Influenza A
hgl05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101704157 (Socs3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101704157 (Socs3)
   04668 TNF signaling pathway
    101704157 (Socs3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101704157 (Socs3)
   04920 Adipocytokine signaling pathway
    101704157 (Socs3)
   04917 Prolactin signaling pathway
    101704157 (Socs3)
   04935 Growth hormone synthesis, secretion and action
    101704157 (Socs3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101704157 (Socs3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101704157 (Socs3)
   04932 Non-alcoholic fatty liver disease
    101704157 (Socs3)
   04931 Insulin resistance
    101704157 (Socs3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101704157 (Socs3)
   05164 Influenza A
    101704157 (Socs3)
   05168 Herpes simplex virus 1 infection
    101704157 (Socs3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hgl04121]
    101704157 (Socs3)
Ubiquitin system [BR:hgl04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     101704157 (Socs3)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 101704157
NCBI-ProteinID: XP_004860883
UniProt: G5AVF0
LinkDB
Position
Un
AA seq 226 aa
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGASSSPPSEPSSPSEEPEQQPPAQPPPGSPPRKAYYIYSGGEKIPLVLS
RPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 681 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcagtgcgcaag
ttgcaggagagcggtttctactggagcgccgtgaccggcggcgaggcaaacctgctgctc
agcgccgagccggccggcaccttcctcatccgcgacagctcggaccagcgccacttcttc
acgctgagcgtcaagacccagtccgggacgaagaaccttcgcatccaatgcgagggtggc
agcttctcgctccagagcgacccgcggagcacgcagcccgtgccccgcttcgactgcgtg
ctcaaactggtgcaccactacatgccgccccccggcgcctcctcctcgcccccttccgaa
ccctcctcgccctccgaggagcctgaacagcagccgcctgcccagccgcctccagggagc
cctcccaggaaagcctattacatctactcggggggcgagaagatccccctggtgttgagc
cggcccctctcctccaacgtggccacccttcagcatctctgtcggaagactgtcaatggg
cacctggactcttacgagaaagtcacccagctgccggggcccatccgggagttcctggac
cagtacgatgcgcccctttaa

KEGG   Heterocephalus glaber (naked mole rat): 101704725
Entry
101704725         CDS       T02812                                 

Gene name
Socs4
Definition
(RefSeq) suppressor of cytokine signaling 4
  KO
K04697  suppressor of cytokine signaling 4
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04630  JAK-STAT signaling pathway
hgl04910  Insulin signaling pathway
hgl04917  Prolactin signaling pathway
hgl04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101704725 (Socs4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101704725 (Socs4)
   04917 Prolactin signaling pathway
    101704725 (Socs4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101704725 (Socs4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hgl04121]
    101704725 (Socs4)
Ubiquitin system [BR:hgl04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     101704725 (Socs4)
SSDB
Motif
Pfam: SOCS SOCS_box SH2
Other DBs
NCBI-GeneID: 101704725
NCBI-ProteinID: XP_004835552
LinkDB
Position
Un
AA seq 417 aa
MAESSDSSNKSADVRPKTSRSRSADRKDGYVWSGKKLSWSRRAEGPGAEVQDGDGDGERG
PERKHSCSALELDLGHSCGQRFLGRSLKQKLQDAVGQCFPIKNCSSRHSPGLPSRRKIHI
SELMLDKCPFPPRSDLAFRWHFIKRHTVPLSPKPDEWGRTDLAQRDLRAGQLPPSRAAAE
APPCAPAPGCAASPASSSSVEDSDMDSDEDLVTLCASSRKRNKPKWEDEELLRLETPPKC
HTQVDYVHCLVPDLLRINNNPCYWGVMDKYRAEALLEGKPEGTFLLRDSAQEDYLFSVSF
RRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGLLEHYKDPGACMFFEPLLSTPLIRT
FPFSLQHICRTVICNCTTYDGIDALPIPPPMKLYLKEYHYKSKVRVLRLDAPAASQC
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggcagaaagtagtgacagtagtaataaaagcgcggacgtgaggcccaagacgagccgg
agcaggagcgcggaccggaaggacggctacgtgtggagcggcaagaagctgtcgtggtcg
cggagggccgagggcccgggtgccgaggtgcaggacggggacggcgacggcgagcggggc
ccggagcggaagcacagctgctcggcgctcgagctggacctgggccactcgtgcgggcag
cgcttccttggccgctctctgaagcagaagctgcaggacgccgtgggccagtgcttcccc
atcaagaactgtagcagccgccactccccggggcttccgtcacggaggaagatccacatc
agcgagctcatgctggataagtgtcctttcccaccgcgatcggacctggccttccggtgg
cacttcatcaagcggcacaccgtgccgctgagtcccaagcccgacgagtggggccgcacg
gacctcgcccagcgtgacctgcgggccggacagctgccgcccagcagagccgcggccgag
gccccgccctgcgccccggcgcccggctgcgcagccagcccggcgtccagcagcagcgtg
gaggacagcgacatggactcagacgaggacctcgtcacgctgtgcgccagctccaggaag
aggaacaagcccaagtgggaggacgaggagctgctgcggctggagacaccgcccaagtgc
cacacgcaggtggactacgtgcactgcctggtgcccgacctgctgcgcatcaacaacaac
ccctgctactggggcgtgatggacaagtacagggccgaggcgctgctcgagggcaagccc
gagggcaccttcctgctccgggactcagcgcaggaggactacctgttctccgtcagcttc
cgccgctacagccgctcgctgcacgccaggatcgagcagtggaaccacaacttcagcttc
gacgcgcacgacccctgcgtcttccactcccccgacatcaccgggctgttggagcactac
aaggaccccggcgcctgcatgttcttcgagcccctcctgtccacgccgctcattcggact
ttccccttctccctgcagcacatctgcaggacagtcatctgcaactgtaccacctatgac
ggcatcgacgccctgcccatccctccgcccatgaagctgtacctgaaggagtatcattac
aaatcaaaggtcagagtcctcaggctcgacgcgcccgcggccagccagtgctag

KEGG   Heterocephalus glaber (naked mole rat): 101706091
Entry
101706091         CDS       T02812                                 

Definition
(RefSeq) suppressor of cytokine signaling 6
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04630  JAK-STAT signaling pathway
hgl04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101706091
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101706091
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hgl04121]
    101706091
Ubiquitin system [BR:hgl04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     101706091
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 101706091
NCBI-ProteinID: XP_004861473
LinkDB
Position
Un
AA seq 537 aa
MKKISLKTFRKSFNLSKSKEETDFMVVQQPSIASDFGKDDALFGSCYGKDMASCDINSED
EKGGKNRSKSESLMGTLKRWLSSKQKPKGKGSTPSGSCADEDTFSSSSAPMVFKDVRVKK
PIRSTSLRSQHYTHTPWPRGPTNSEETYIKTEVRVKALVHSSSPSPALNAVRKDFHDLQS
ETVCQEQNNSLKSSDSPNGDLHFHLDEHVPVVIERKPQDYIQYTVPLDERMYPLEGSRSY
CLNSSLPMEVSAVPPQVGGSSFAEDENEVNQDLVVAPEIFVDQSVNGLLIGITGVMLQSP
RASRDDVPPLSPLVPTMQNNQIQRNFSGLTGTDAHVAESMCCHLNFDPYPNSAPGVARVY
DSVQSSGPRVVASLTEELKKLAKQGWYWGPLTRWEAEGKLANLPDGSFLVRDSSDDHYLL
SLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHRSIVDLIKHSIRDSENGAFCYSRSPLP
GSATYPVRLTSPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgaagaaaattagtcttaaaaccttccggaagtcttttaacttgagtaaaagtaaagaa
gaaactgatttcatggtagtacaacaaccatcaatagccagtgactttggaaaagatgat
gccttgtttggtagctgctatggtaaagatatggccagctgtgatatcaacagtgaagat
gaaaaaggtgggaaaaacagatcaaaaagtgagagcctgatgggaaccttaaaaaggtgg
ctttcttctaagcagaagccaaagggcaagggcagcacaccgtcaggaagctgtgccgat
gaggacaccttctcctcctcctcagcccccatggtcttcaaagatgtcagagtgaaaaag
ccaatcaggtctacttccctccgcagtcagcactacacccacacgccctggcctcgcggg
cccacaaactccgaggagacttacatcaaaacggaggtcagggtcaaagccttggttcac
tcttccagcccaagtcctgcactgaatgctgttcgaaaggattttcatgaccttcagtct
gaaactgtatgccaagagcaaaataattctcttaagagttctgattctcccaatggagat
ttgcatttccacctggatgaacatgtgcctgtagttattgaacgtaagccccaggactac
attcagtatactgtgcctttagacgagaggatgtatcctttggaaggatcacgtagctat
tgtctgaacagttctttgcccatggaggtctctgcagttcctcctcaagtgggagggagc
tcttttgctgaagatgagaatgaggtaaaccaggacctagttgttgccccagagatcttt
gtggatcagtctgtgaatggcttgttgattggcatcacgggagtcatgttgcagagcccc
agagcaagtcgtgatgatgtccctccactttcacctttggtacctacaatgcagaataat
caaatccaaaggaacttcagtggactcactggcacagatgcccacgtggctgaaagtatg
tgttgtcatttgaattttgatccataccctaactctgctcctggggttgcaagagtttat
gattcagtgcagagtagtggtcccagggttgtggcaagccttacagaggagctgaagaaa
cttgcaaaacaaggatggtactggggaccactcacacgctgggaggcagaagggaaacta
gcaaacttgccagatggttcttttcttgttcgggatagttctgatgatcattatctttta
agcttgagctttcgttcccatggtaaaacacttcacactagaattgagcactcaaatggt
aggtttagcttttatgaacaaccagatgtggaagggcacagatctatagttgatctaatt
aagcattcaatcagggactctgaaaatggagctttttgttattcgaggtctccattgccc
ggatctgcaacttaccctgtcagactgaccagtccagtgtcacggttcatgcaggtgcgt
tctttgcagtacctgtgtcgttttgttatacgtcagtataccagaatagacttaattcag
aaactgcctttgccaaacaaaatgaaggattatttacaggagaagcactactga

KEGG   Heterocephalus glaber (naked mole rat): 101716336
Entry
101716336         CDS       T02812                                 

Gene name
Socs6
Definition
(RefSeq) suppressor of cytokine signaling 6
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04630  JAK-STAT signaling pathway
hgl04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101716336 (Socs6)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101716336 (Socs6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hgl04121]
    101716336 (Socs6)
Ubiquitin system [BR:hgl04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     101716336 (Socs6)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 101716336
NCBI-ProteinID: XP_004862027
LinkDB
Position
Un
AA seq 535 aa
MKKISLKTFRKSFNLSKSKEETDFMVVQQPSIASDFGKDDALFGSCYGKDMASCDINSED
DKGGKNRSKSESLMGTLKRRLSSKQKPKGKGSTPSGSCADEDTFSSSSAPIVFKDVRAQR
PIRSTSLRSHHYSPTPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFRDLQS
ETVCQEQNNSLKSSDSPNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSY
CLDSSSPMEVSAVPPQVGGSSFAEDENQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSP
RASHDDVPPLSPLLPPMQNNQIQRNFSGLTGTDAHVAESMRCHLNFDPNSAPGVARVYDS
VQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSL
SFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGS
ATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgaagaaaattagtcttaaaaccttccgaaagtcttttaacttgagtaaaagtaaagaa
gaaactgatttcatggtagtacaacaaccatcaatagccagtgactttggaaaagatgat
gccttgtttggtagctgctatggtaaagatatggccagctgtgatatcaatagtgaagat
gacaaaggtgggaaaaacagatcaaaaagtgagagcctgatgggaaccttaaaaaggcgg
ctttcttctaagcagaagccaaagggcaagggcagcacaccgtcaggaagctgtgccgat
gaggacaccttctcctcctcctcagcccccatcgtcttcaaagatgtcagagcgcaaagg
ccgatcaggtccacttccctccgcagtcatcactacagccccacgccctggcctctccgg
cccacaaactccgaggagacatgcatcaaaatggaggtcagagtcaaagccttggttcac
tcttccagcccgagtcctgcattgaatggtgttcgaaaggattttcgtgaccttcagtct
gaaactgtatgccaagagcaaaataattctcttaaaagttctgattctcccaatggagat
ttacatctccacctggatgaacatgtgcctgtagttattggacttatgcctcaggactac
attcagtataccgtgcctttagacgaggggatgtatcctttggaaggatcacgtagctat
tgtctggacagttcttcacccatggaggtctctgcggttcctcctcaagtgggagggagc
tcttttgctgaagatgagaatcaggtagaccaggacctagttgttgccccagagatcttt
gtggatcagtctgtgaatggtttgttgattggcaccacgggagtcatgttgcagagcccc
agagcaagtcatgatgatgtccctccactttcacctttgctacctccaatgcagaataat
caaatccaaaggaacttcagtggactcactggcacagatgcccatgtggctgaaagtatg
cgttgtcatttgaattttgatcctaattctgctcctggggttgcacgagtttatgactca
gtgcagagtagtggtcccatggttgtgacaagccttacagaggagctgaagaaacttgca
aaacaaggatggtactggggaccgatcacacgctgggaggcagaagggaaactagcaaat
gtgccagatggttcttttcttgttcgggatagttctgatgatcgttatcttttaagcttg
agctttcgttcccatggtaaaacacttcacactagaattgagcactcaaatggtaggttt
agcttttatgaacaaccagatgtggaaggacatacatctatagttgatctaattgagcat
tcaatcagggactctgaaaatggagctttttgttattcgaggtctcggttgcctggatct
gcaacttaccctgtcagactgaccaatccagtgtcacggttcatgcaggtgcgttctttg
cagtacctgtgtcgttttgttatacgtcagtataccagaatagacttaattcagaaactg
cctttgccaaacaaaatgaaggattatttacaggagaagcactactga

KEGG   Heterocephalus glaber (naked mole rat): 101716580
Entry
101716580         CDS       T02812                                 

Gene name
Socs2
Definition
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04630  JAK-STAT signaling pathway
hgl04910  Insulin signaling pathway
hgl04917  Prolactin signaling pathway
hgl04930  Type II diabetes mellitus
hgl04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101716580 (Socs2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101716580 (Socs2)
   04917 Prolactin signaling pathway
    101716580 (Socs2)
   04935 Growth hormone synthesis, secretion and action
    101716580 (Socs2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101716580 (Socs2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hgl04121]
    101716580 (Socs2)
Ubiquitin system [BR:hgl04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     101716580 (Socs2)
SSDB
Motif
Pfam: SOCS_box SH2 SH2_2 Condensation
Other DBs
NCBI-GeneID: 101716580
NCBI-ProteinID: XP_004845017
LinkDB
Position
Un
AA seq 198 aa
MTLRCLEPSGNGAEGAHSQWGTSGSAEEPSPEAARLAKALRELGYTGWYWGNMTVNEAKE
KLKEAPEGTFLIRDSSHSGYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGTVWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaccctgcggtgcctcgagccctccgggaatggtgcggaaggggcgcacagccagtgg
gggacctcggggtcggccgaggagccgtccccggaggccgcgcgtctggccaaggccctg
cgcgagctcggctacacaggatggtactggggaaatatgactgttaatgaagccaaagag
aaattaaaagaagcaccagaaggaactttcttgattcgagatagttcgcattcaggctac
ctgctaacaatatctgttaaaacatcagctggaccaactaatctgcgaattgagtaccaa
gatgggaagttcagactggattctatcatatgtgtcaagtccaagcttaaacagttcgac
agtgtggttcacctgattgactactatgtccagatgtgtaaggataagcggacgggcccg
gaagctccccgaaacgggaccgttcacctttacctgaccaaaccgctgtacacatcagca
ccctccctgcagcacctctgtcgactcaccattaacaaatgcaccggtactgtctgggga
ctgcctttaccaacaagactcaaagattacttggaagaatataaattccaggtgtaa

KEGG   Heterocephalus glaber (naked mole rat): 101723330
Entry
101723330         CDS       T02812                                 

Gene name
Socs1
Definition
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04120  Ubiquitin mediated proteolysis
hgl04380  Osteoclast differentiation
hgl04630  JAK-STAT signaling pathway
hgl04910  Insulin signaling pathway
hgl04917  Prolactin signaling pathway
hgl04930  Type II diabetes mellitus
hgl04935  Growth hormone synthesis, secretion and action
hgl05145  Toxoplasmosis
hgl05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101723330 (Socs1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101723330 (Socs1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101723330 (Socs1)
   04917 Prolactin signaling pathway
    101723330 (Socs1)
   04935 Growth hormone synthesis, secretion and action
    101723330 (Socs1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101723330 (Socs1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101723330 (Socs1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101723330 (Socs1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101723330 (Socs1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hgl04121]
    101723330 (Socs1)
Ubiquitin system [BR:hgl04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     101723330 (Socs1)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 101723330
NCBI-ProteinID: XP_004864951
LinkDB
Position
Un
AA seq 211 aa
MVAHNQVAADNAISTAAEPRRRPEPSSSPSSSPAAPARPRPCLAAPAPTPGDTHFRTFRS
HADYRRITRTSALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMA
SGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGTPLRQRRVRPLQELCRQ
RIVATVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 636 nt   +upstreamnt  +downstreamnt
atggtagcacacaaccaggtggcagccgacaatgcaatctccacggcagcagagccccga
cggcggccagagccttcctcctctccctcctcctcgcccgcggcccccgcgcgccctcgg
ccctgcctggcggccccggccccgacccccggagatacacacttccgcacgttccgctct
cacgcggattaccggcgcatcacgcgcacgagcgcgctcctcgacgcttgcggcttctac
tggggacccctgagcgtgcacggggcgcacgagcggctgcgagccgagcccgtgggcacc
ttcctggtgcgcgacagtcgccagcggaactgcttcttcgccctcagcgtgaagatggcc
tcgggccccacgagcatccgcgtgcacttccaggccggccgcttccacctggacggtagc
cgcgagagcttcgactgcctcttcgagctgctggagcactacgtggcggcgccgcgccgc
atgctgggcaccccgctgcgtcagcgccgcgtgcgccccctgcaggagctgtgccgccag
cgcatcgtggccaccgtgggccgcgagaacctggcgcgcatccctctcaaccccgtcctc
cgagactacctgagctccttccccttccagatctga

KEGG   Heterocephalus glaber (naked mole rat): 101725097
Entry
101725097         CDS       T02812                                 

Gene name
Socs7
Definition
(RefSeq) suppressor of cytokine signaling 7
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04630  JAK-STAT signaling pathway
hgl04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101725097 (Socs7)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101725097 (Socs7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hgl04121]
    101725097 (Socs7)
Ubiquitin system [BR:hgl04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     101725097 (Socs7)
SSDB
Motif
Pfam: SOCS_box SH2
Other DBs
NCBI-GeneID: 101725097
NCBI-ProteinID: XP_004859609
LinkDB
Position
Un
AA seq 573 aa
MVFRNVGRPPEDEDAEAAPGPGPTELLCPRHRCALDPKALPPGLALEQAWGPAAGLEAQL
AALGLGQPAGPGGKAAGGGCCPCPCPAQPPAPQPPPPAAAPQAGEDPTETSDALLVLEGL
ESEAESLETNSCSEEELSSPGRGGGGGGRLVLQPSGPDLPPALFPLQDLVPSGRPSRAEQ
QPPPPPAGPLRPLAGPSRKGSFKIRLSRLFRTKSCNGGSGGGDGTGKRPSGELATSAASL
TDVGCSAGREVDSGRKPRLTRTQSAFSPASFSPLFTGETVSLVDVDISQRGLSSPHPPTP
PPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDAFPRIAPIRATESL
HSQPPQHLQCPLDRPDSSSFTASLRELEQCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSS
DPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFL
YFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYI
RKFYYYDPQEEVYLSLKEAQLISRQKQEVEPST
NT seq 1722 nt   +upstreamnt  +downstreamnt
atggtgttccgcaacgtggggcggccgccggaggacgaggacgcggaggcggcgccgggc
ccgggacccacggagctgctgtgtccgcggcaccgctgcgccctggaccccaaggccctg
ccgccgggcttggcgctcgagcaggcctggggcccggccgcgggactggaggcgcagctg
gcggccctggggctcgggcagccggcgggcccggggggcaaggcagctggcgggggctgc
tgcccgtgcccttgccccgcgcagccgcctgctccgcagcccccgccgccggccgccgcc
ccgcaggccggggaggaccccacggagacgagtgacgcgctgctggtgctggagggctta
gagtcggaggctgagagcctggaaaccaacagctgctcggaagaggagctcagcagcccg
ggccgcggaggaggagggggcggccggctggtgctgcagccctcgggccccgatctgccc
ccagcgctcttcccgctgcaggacttggtcccttcggggcggccgagccgagccgagcag
cagccgccgccgccgcccgctgggcctctccggcccctcgcgggcccctctcggaagggc
tccttcaagatccgcctcagccgcctcttccgcacgaagagctgcaacggcggctcgggc
ggcggggacgggaccggcaagaggccttctggagagctggccacctcagccgcgagcctc
accgacgtgggatgctctgcgggtcgggaggtggactcggggaggaaacccaggttgaca
agaactcaaagtgccttttctccggcctccttcagccccctgttcacaggtgaaacagtg
tcgcttgtggacgtggacatttctcagcggggcctgagctccccacaccctccaactccc
cctcctcctccgagaagaagcctcagcctcctagatgatatcagtgggacgctgcctaca
tctgtccttgtggctccgatggggtcttccctgcagtccttcccccttcctccgcctcct
ccgccccatgccccagatgcatttccccggattgctcccatccgagccaccgagtccctg
cacagccagcccccccagcacctgcagtgtcccctcgaccggccggactcgagcagcttc
acggccagccttcgagagctggagcagtgtggttggtattgggggccaatgaattgggag
gatgcagagatgaagctgaaagggaagccggatggttctttcctggtgcgagacagctcc
gaccctcggtacatcctgagcctcagtttccggtcccagggcatcactcaccacactagg
atggagcactaccgaggaacctttagcctgtggtgccatcccaagtttgaggatcgctgt
cagtccgtggtggagttcatcaagagagccatcatgcactccaagaacgggaagttcctc
tacttcctgagatccagggttccagggctgcctcccacgccagttcagctgctctacccc
gtgtcccgattcagcaatgtcaagtccctccagcacctttgccgattccggatccgacag
ctcgtgcggatagatcacatcccggatctcccattgcctaaacctctgatctcttatatc
cgaaagttctactactatgatcctcaggaagaggtatacctttcgctaaaggaagcgcag
ctcatttccagacagaagcaggaggtggaaccctccacgtag

DBGET integrated database retrieval system