KEGG   Heterocephalus glaber (naked mole rat): 101703133Help
Entry
101703133         CDS       T02812                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04614  Renin-angiotensin system
hgl04924  Renin secretion
hgl05142  Chagas disease (American trypanosomiasis)
hgl05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    101703133
   04614 Renin-angiotensin system
    101703133
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    101703133
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    101703133
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hgl01002]
    101703133
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hgl04147]
    101703133
   04090 CD Molecules [BR:hgl04090]
    101703133
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     101703133
Peptidases [BR:hgl01002]
 Metallo Peptidases
  Family M2
   101703133
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101703133
CD molecules [BR:hgl04090]
 Proteins
  101703133
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 DUF1138 SmpA_OmlA
Motif
Other DBs
NCBI-GeneID: 101703133
NCBI-ProteinID: XP_012922472
LinkDB All DBs
Position
Un
AA seq 721 aa AA seqDB search
MGTKWTPGSSLLVLLYYGQLFPWLRIVGDPSLDDHMMPFLEMCTTETKLFLKFYDQTAKI
VLNQFTEATWNYVTSITKSNQEEILLKEVERSQFMIYFGTWAHLFKIAQFQDTAVKHMLS
KLQDIGKVATLPQDELWEYNXLLSYMETTYSRAQVCLDEGPCMPLEPAECTDLEEIMATS
RDQNELLWAWEGWRDSVGHILRPIFWRYVEVSNKAAQLNGYKDMGALWCAKYESDTLEQD
LEQLYRELQPLYLNLHAYVRRTQHRHCGPELINLRGPIPARLLGNMWARSWVKILDLVLP
FLKKPLKDIKKIMRMHMYSPFPAPLEAWESKFFTSLGLSAPPDFWKKSVLERPTDGQEAE
CQTSAWDFYTGDDFRIKKYTEVTIGDLLSIFHQMGHNQYFLQCQNPPVIFHEGANPALGD
AVGSIATLSAPSHKHLFTTGLLSLQLQDSEEEINFLLGIALEKIAFIPFSYLVDVFRWKV
FDGTIQKHIYNQEWWKLRLKHQGLWPPVPRTEDDFDPGAKFHVSASVPYIRYFLSLVLQF
QLHKALCNASGHVGPLHQCDISSSKMAGKILGNALKLGSSRPWPEVPKELTGQSNMSTKA
PIKPLLNWLVAENVRQGEILGWPDFTCSFEERTNKVDLLGLLLKPGQVTFGQWVLLFLSF
VMFLVVLGLAYRLYFLEKWSLDQDSMILSSLPSTYFLGVAMEPQQATRRQWILLGLCFIL
M
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgggaacaaaatggactcctggatcttccctacttgtgctcctctactatgggcagctc
tttccttggcttaggattgtgggtgatccaagcttagatgaccacatgatgcccttcctg
gagatgtgtactactgagacaaagctgttcctgaagttttatgatcaaacagccaagatt
gtgttgaatcagttcacagaggccacttggaactatgtcaccagcatcaccaagtcaaat
caggaggaaatactgctgaaggaggtagagaggtcccagttcatgatatactttggcacc
tgggcccacctatttaagattgcccagttccaggacacagctgtgaagcacatgctgagt
aagctgcaggacataggcaaggtggccaccttgccccaggacgagctctgggagtacaac
tagcttctgtcctacatggagacgacatatagcagggcccaggtgtgcctggatgagggg
ccctgcatgccccttgagcctgctgagtgcacagatcttgaagaaatcatggccacctcc
agggaccagaatgagctcctgtgggcctgggagggctggcgggactctgtgggtcacatc
ctccgccccatcttctggcgctacgtggaggtcagcaacaaagctgcacagctcaatggc
tacaaagacatgggagctttgtggtgtgctaagtatgaatcagacaccctggaacaagac
ctggagcaactttaccgagagctgcagccgctctacctcaacctgcatgcgtatgtgcgc
cgcacccagcaccgccactgtgggcctgaactcatcaatttgcggggacccatccctgcc
cgtctgctggggaacatgtgggctcggtcctgggtcaagatcctagacctggtcctgcct
ttccttaagaagcccctcaaggacatcaagaagattatgagaatgcacatgtactccccc
ttccccgcacccctggaagcctgggaaagcaaattcttcacctccttggggctgtctgcc
ccacctgatttctggaaaaagtcagtgctggagaggccgactgatgggcaggaggcggaa
tgccaaacctctgcctgggacttctacactggcgatgacttcaggataaagaaatacacg
gaagtgaccataggagacctgctctccatcttccaccagatgggtcataaccagtacttc
ttgcaatgccagaacccccctgtaatcttccatgaaggtgccaaccctgctttgggggat
gctgtgggatcaatagccactctctctgccccttcccacaagcacctgttcaccacaggc
ctgctcagcctccagctccaggactcagaggaggaaatcaacttcctgctgggcattgcc
ctggagaagatcgccttcatccccttcagctatctggtggacgtgtttcgctggaaggtc
tttgatggcaccatccagaagcacatctacaaccaggagtggtggaagctcaggttaaag
caccaggggctgtggccacctgttcctcggacagaggatgactttgacccaggtgccaag
ttccatgtttctgccagtgtgccctatattcggtatttccttagcttagtgctccagttc
cagcttcacaaggcactgtgcaatgcctcaggccatgtaggtccgctgcaccagtgtgac
atctctagctccaagatggctgggaagatcctggggaatgccctgaagctgggctcgagc
aggccctggccagaggtcccaaaggagctgactgggcagtccaacatgtctacaaaggcc
cccatcaagccactcctgaactggctagtggctgagaatgtgcggcagggagaaatcctg
ggctggccagacttcacctgttcctttgaagaaagaacaaacaaagtggatttactgggt
ctgctgttgaagcctggccaggttacatttgggcagtgggtgctgctgtttctgagcttt
gtcatgttcctggtggtcctgggactggcctacaggctgtacttcctggaaaaatggtca
ctagaccaggacagcatgatactcagttccctgccctccacctatttcctgggagtggcc
atggagccccaacaggctacccgaagacagtggatcctgctgggcctctgcttcatcctc
atg

DBGET integrated database retrieval system