KEGG   Heterocephalus glaber (naked mole rat): 101703313Help
Entry
101703313         CDS       T02812                                 

Gene name
Map3k14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04010  MAPK signaling pathway
hgl04064  NF-kappa B signaling pathway
hgl04210  Apoptosis
hgl04380  Osteoclast differentiation
hgl04625  C-type lectin receptor signaling pathway
hgl04660  T cell receptor signaling pathway
hgl04668  TNF signaling pathway
hgl04672  Intestinal immune network for IgA production
hgl05166  Human T-cell leukemia virus 1 infection
hgl05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101703313 (Map3k14)
   04064 NF-kappa B signaling pathway
    101703313 (Map3k14)
   04668 TNF signaling pathway
    101703313 (Map3k14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101703313 (Map3k14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101703313 (Map3k14)
   04660 T cell receptor signaling pathway
    101703313 (Map3k14)
   04672 Intestinal immune network for IgA production
    101703313 (Map3k14)
  09158 Development
   04380 Osteoclast differentiation
    101703313 (Map3k14)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    101703313 (Map3k14)
   05169 Epstein-Barr virus infection
    101703313 (Map3k14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101703313 (Map3k14)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     101703313 (Map3k14)
Protein kinases [BR:hgl01001]
 Serine/threonine kinases: STE group
  Other
   101703313 (Map3k14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 101703313
NCBI-ProteinID: XP_004859231
UniProt: G5BIZ1
LinkDB All DBs
Position
Un
AA seq 933 aa AA seqDB search
MAVMEVACPGGPASTVEQQKELAKAQEKTQVLGQKLEAVGRSPVFCGKWAILNDVITKGT
AKEGSERGLAAVSIIAQPECENSQEFSPTFSGRIFIAGSKQYSQSESLDQIPNNVAHATE
GKTAPVCWKGKRRSRARKKRKKKSSKSLAEAGVALAKPLPRTPEQESCTVPVQEDESPLG
ARYTRHGPQFTRPLKDPGSGHLCFKKLDEGLRPVPPRPELHKLISPLQCLNHVWKLHHPQ
DAAPLPRPARPFPYSRLPHPFPFHPLQPWKPHPLDSCLGKVACAQGQQPLPAPALGKPGC
GDSPKLLPGPPHEPTCLAHTREKCSVEEYLTHALRGSVSSGRARSLATLAKTWAGGPGPQ
RPSPETEDNEGVLLSEKLKPVDYEYREEVHWATHQPRLGRGSFGEVHRMRDKQTGFQCAV
KKVRIEVFRAEELTACAGLSSPQIIPLYGAVREGPWVNIFMELLEGGSLGQLIKQMGCLP
EDRALFYLAQALEGLEYLHARRVLHGDVKADNLLLSSDGNRAALCDFGHAVCLRPSGLGK
SLLTGDYIPGTETHMAPEVVLGKPCDTKVDIWSSCCMMLHMLNGCHPWTQYFRGPLCLKI
AREPPPVREIPASCGPLTAQAIRQGLRKEPVQRASAGELLGKVCGALQQVGGLQSPWRGD
CKELRLPTDQAARRPTPSAPLRECPPPEDDMGLGLSPELQPPPPPEPPEQNVSPTLHLSE
DDSGPWEPLPLSSLDPVPARSSGSLERRATLPDLELQQLEIELFLNSLSQPFSLEEQEQI
LSCLSIDSLSLSDTTEKNPSKASQSSRDTLSSGVHSWGSQAEARSSSYSAVLARGRPADT
PSYFNGVKVQIQSLNGEHLHIREFHRVKVGDIATGISSQIPATAFSLVTKDGQPVRYDME
VPDSGIDLQCMLAPDGSFAWSWRVKHGQLENRP
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatggaagtggcctgccccggaggccctgcctccacagtggagcagcagaag
gagctcgccaaagcccaggagaagacacaggtgctcgggcagaagctggaggccgtgggc
aggagccccgtgttctgcggaaaatgggccatcctgaacgacgtgatcaccaaaggcact
gccaaggagggctctgagcggggcctggccgccgtctccatcatcgcccagccagagtgt
gagaacagccaggagttcagccccaccttctcaggaagaatcttcatcgccggctcgaag
cagtacagccagtcggagagtctcgatcaaatccccaacaatgtggcccatgcgaccgag
ggcaaaacggcccccgtgtgttggaagggaaagcgtcgcagcagagcccggaagaaacgg
aagaagaagagctcgaagtccctagcagaagccggagtggccttggccaagcccctgccc
aggacccccgagcaggagagctgcacggtcccagtgcaggaggacgagtctccgctaggt
gcccggtacaccagacacggcccccagttcaccaggcctctgaaggacccaggctcaggc
cacctctgctttaagaaactggacgagggcctgcggccagtgccgccacgaccggaactc
cacaagctgatcagccctttgcaatgtctaaaccatgtgtggaaactgcaccacccccag
gacgcggcccccctgccccgtcccgcccgccccttcccctacagcagactgccccatccc
ttccccttccaccctctgcagccctggaagcctcaccccctggactcctgcctgggcaag
gtggcctgtgcacaaggccagcagcccctgcctgccccggccctgggcaaaccgggctgt
ggggacagtccgaagctgctccccggcccgccccatgagcccacctgcctggctcatacc
cgggagaagtgctctgtggaggagtacctgacacacgctctgcgtggcagcgtgagctct
ggccgggcccgcagcctggccaccctggccaagacctgggcgggcggccccgggccccag
aggcctagccctgaaaccgaggacaacgagggggtgctgcttagtgagaaactcaagcca
gtggattacgaataccgagaagaggtgcactgggccacccaccagccccgcctgggcaga
ggctccttcggagaggtgcacaggatgagggacaagcagacaggtttccagtgtgctgtc
aaaaaggtgcggatcgaggtgtttcgggcagaagagctgacggcatgtgcaggactgagc
tcgccccaaatcatccctctgtatggcgcagtaagggaaggtccttgggtcaacatcttc
atggagctgctggaaggtggctccctgggccagctcataaagcagatgggctgtctacca
gaggaccgagccctcttctacctggcccaggcgttagaggggctggagtacctgcatgcc
cgaagggttctgcacggagacgtcaaagctgacaacctgctcctgtccagcgatgggaac
cgcgcagctctctgcgacttcggccatgctgtgtgcctgcgacccagcggcctggggaag
tccttgctcacaggtgactacatcccaggcacagagacccacatggccccggaggtggtg
ctggggaagccctgtgacaccaaggtggacatctggagcagctgctgcatgatgctgcac
atgctgaatggctgccatccctggacccagtacttccgagggccgctctgcctcaagatt
gcccgtgagcccccacccgtgagggagatcccagcttcctgcggccctctcactgcccag
gccatccggcagggcctgaggaaggagcctgtccaacgcgcgtcagccggggagctgctg
gggaaggtgtgtggggcactgcagcaagtgggaggtctgcagagcccctggaggggagac
tgtaaggagctgagactcccgacagaccaggccgcccgccgcccaaccccaagtgccccg
ctgcgggagtgcccacccccggaggacgacatgggcctgggcctgtccccagagcttcag
ccaccgccgccaccagagcccccagagcagaacgtgtctcccaccctgcatctgagcgag
gacgactctggcccctgggaacccctgcctctgtcctccctggacccagtcccggctagg
agctcgggctcgctggagcggagagcaaccctccctgacctggagctgcagcagctggag
atagaattgtttctgaacagcctgtcccagcctttctctctggaggagcaggagcagatt
ctctcgtgcctcagcatcgacagcctctccctgtcagacaccactgagaagaacccatca
aaggcctctcagagctcgagggacaccctgagctctggcgtccactcatggggcagccag
gcagaggctcggagctccagctacagcgcggtgctggcccggggacgacctgccgacacc
cccagctacttcaatggagtgaaagtccaaatacagtctctcaatggcgaacacctgcac
atccgagagttccaccgggtcaaagtgggagacatcgcaactggcatcagcagccagatc
ccagccacagccttcagcttggtgaccaaagacgggcagcccgttcgctatgacatggag
gtgccagactcgggcatcgacctgcagtgcatgctggcccccgacggcagctttgcctgg
agctggcgggtgaagcatggccagctggagaacaggccgtag

DBGET integrated database retrieval system