KEGG   Heterocephalus glaber (naked mole rat): 101703324Help
Entry
101703324         CDS       T02812                                 

Gene name
Gclm
Definition
(RefSeq) glutamate-cysteine ligase modifier subunit
  KO
K11205  glutamate--cysteine ligase regulatory subunit
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00270  Cysteine and methionine metabolism
hgl00480  Glutathione metabolism
hgl01100  Metabolic pathways
hgl04216  Ferroptosis
Module
hgl_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    101703324 (Gclm)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101703324 (Gclm)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    101703324 (Gclm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 101703324
NCBI-ProteinID: XP_004841294
UniProt: A0A0P6J709
LinkDB All DBs
Position
Un
AA seq 274 aa AA seqDB search
MGTNSRAAGALLARASTLHLQTGNLLNWGRLRKKCPSTHSEELRDCIQKTLNEWSSQISP
DLVKEFPDVLECTVSYAIEKINPDEREEMKVSAKLFIVGSNSSSSTRNAVDMACSVLGVA
QLDSVIIASPPIEDGVNLSLEHLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQ
VKPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQETIPDIQAH
EWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccaacagccgcgcggccggggcgctcctggcgcgggccagcaccctacacctg
cagaccgggaacctgctaaactggggccgcctgcggaagaagtgcccgtccacgcacagc
gaggagcttcgagattgtatccaaaagaccttgaatgagtggagttctcaaatcagccca
gatttggtcaaggagtttccagatgtcttggagtgtactgtatcttatgcaatagagaag
ataaaccctgatgaaagagaagaaatgaaagtttctgcaaaactgttcattgtaggatca
aattcttcatcatcaactagaaatgcagttgacatggcctgttctgtccttggagttgca
cagctggattctgtgatcattgcttcacctcctattgaagatggagtgaatctttccttg
gagcatttacagccttactgggaggaattagaaaacttagtccaaagcaagaaaattgtt
gctataggtacctctgacctagacaaaacacagttggagcagctgtatcagtgggcacag
gtaaaaccaaatagtaaccaagttaatcttgcctcctgctgtgtgatgccacctgatttg
actgcatttgctaaacagtttgacatacagctgttgactcataatgatccaaaagaactg
ctttctgaagcaagtttccaagaagctcttcaggaaaccatccctgacattcaagcacac
gaatgggtaccactgtggctgctgaggtactcggtcattgtgaaaagtagaggaatcatc
aaatcgaaaggctacattttgcaagccaaaagaaggggttcttaa

KEGG   Heterocephalus glaber (naked mole rat): 101718793Help
Entry
101718793         CDS       T02812                                 

Gene name
Gclc
Definition
(RefSeq) glutamate-cysteine ligase catalytic subunit
  KO
K11204  glutamate--cysteine ligase catalytic subunit [EC:6.3.2.2]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00270  Cysteine and methionine metabolism
hgl00480  Glutathione metabolism
hgl01100  Metabolic pathways
hgl04216  Ferroptosis
Module
hgl_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    101718793 (Gclc)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101718793 (Gclc)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    101718793 (Gclc)
Enzymes [BR:hgl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.2  glutamate---cysteine ligase
     101718793 (Gclc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCS GCS2
Motif
Other DBs
NCBI-GeneID: 101718793
NCBI-ProteinID: NP_001290235
UniProt: A0A0A7HV47
LinkDB All DBs
Position
Un
AA seq 640 aa AA seqDB search
MGLLSQGSPLSWEETRRHADHVRRHGILQFLHIYHAVKDRQKDVLKWGDEVEYMLVSFDH
ENKKVQLILNGEDVLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTV
EDNMRKRRQEATSVLEENQALCTITSFPRLGCPGFTLPVYKPNPVEGGASKSLFFPDEAI
NKHPRFSTLTRNIRHRRGEKVVINVPIFKDKNTASPFIETFPEDDEAARASKPDHIYMDA
MGFGMGNCCLQVTFQACSISEASYLYDQLATICPIVMALSAASPFYRGYVSDIDCRWGVI
SASVDDRTREERGLEPLKNNNYRISKSRYDSIDSYLSKCGEKYNDIDLTIDKGVYEQLVQ
NGIDHLLAQHVAHLFIRDPLTLFKEKIDLDDANESDHFENIQSTNWQTMRFKPPPPHSDI
GWRVEFRPMEVQLTDFENSAYVVFVVLLTRVILSYKLDFLIPLSKVDENMKVAQKRDAVL
QGMFYFRKDICKGGNTVVDGCGKAPAGGADLSSEEYALMSIDTIINGKEGVFPGLIPILN
SYLENMEVDVDTRCSIMNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNY
NLILKCNQIANELCECPELLGSGSAFRKVRYSGSKTDSSS
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggggcttctgtcccagggctcgccgctgagctgggaggagacccggcgccacgctgac
cacgtgcggcggcacggcatcctgcagttcctgcacatctaccacgccgtcaaggaccgg
cagaaggacgtgctcaagtggggcgacgaggtggaatacatgttggtatcttttgatcat
gaaaataagaaggtccagttgatcctgaatggagaagatgttcttgaaactctacaagag
aagggggaaaggacaaatccaaaccatcctaccctttggagaccagagtatgggagttac
atgattgaagggacacctggacagccctacggagggactatgtctgaattcaacacggtg
gaggacaacatgaggaagcgccgccaggaggctacctccgtattagaggaaaaccaggct
ctttgcacaataacttcatttcccagattaggctgtcctgggttcacactgcccgtgtat
aaacccaacccagtcgaaggaggagcatcaaagtccctcttctttccagatgaagcaata
aataagcacccccgcttcagtaccctgacaagaaatatccggcacaggagaggggagaag
gttgtcatcaacgtaccaatatttaaggacaagaacacagcgtctcccttcatagaaaca
tttcctgaggatgatgaggcagccagggcttccaagccagatcacatttacatggacgcc
atgggattcgggatgggcaattgctgccttcaggtgacgttccaagcctgcagcatatct
gaggccagttacctttacgatcagctggccactatctgtccaattgttatggctttgagt
gctgcgtctcctttttaccgaggctacgtgtcagacattgattgtcgctggggagtgatc
tctgcatctgtagatgacagaactcgggaagagagaggactggagccactgaagaacaat
aactatcgaatcagtaagtcccgatacgactccatagacagctacttatctaagtgtggt
gagaaatacaacgacatcgacctgaccatagataaaggagtctatgagcagctggtgcag
aacggcatcgatcaccttctggcccagcatgttgctcatctcttcatcagagaccccctg
acgttgttcaaagagaaaatcgacctggatgatgctaatgagtctgaccattttgagaat
attcagtccacaaattggcagacaatgagattcaagcccccgccccctcactccgacatt
ggctggagagtggaattccgccccatggaggtgcagttgactgactttgagaactccgcc
tatgtggtgtttgtggtgctgctcaccagagtgatcctctcatacaagctggacttcctc
attcctctctccaaggttgatgaaaacatgaaagtagcacagaaacgagatgctgtcttg
cagggaatgttttatttcaggaaagatatttgcaaaggtggcaacactgtggtggacggg
tgtggtaaggcccctgctggcggcgcagacctgtcctcagaggagtatgcgctcatgagc
atagacaccatcatcaacgggaaggaaggtgtttttcctggactcatcccaatcctgaat
tcttacctggaaaatatggaggtggatgtggataccagatgcagtattatgaactacctg
aagctaattaagaagagagcatctggagaactaatgacagttgccaggtggatgagagaa
ttcattgcaaaccatcctgactacaagcaagacagtgtaataactgatgaaatgaactat
aaccttattttgaagtgtaaccaaattgcaaatgaattatgtgaatgcccagagttacta
ggatcaggatcagcatttaggaaagtaaggtacagtggaagtaaaactgactcttccagc
tag

DBGET integrated database retrieval system