KEGG   Heterocephalus glaber (naked mole rat): 101703463
Entry
101703463         CDS       T02812                                 

Gene name
Ldlr
Definition
(RefSeq) low density lipoprotein receptor
  KO
K12473  low-density lipoprotein receptor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04144  Endocytosis
hgl04913  Ovarian steroidogenesis
hgl04925  Aldosterone synthesis and secretion
hgl04927  Cortisol synthesis and secretion
hgl04934  Cushing syndrome
hgl04976  Bile secretion
hgl04979  Cholesterol metabolism
hgl05145  Toxoplasmosis
hgl05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101703463 (Ldlr)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    101703463 (Ldlr)
   04925 Aldosterone synthesis and secretion
    101703463 (Ldlr)
   04927 Cortisol synthesis and secretion
    101703463 (Ldlr)
  09154 Digestive system
   04976 Bile secretion
    101703463 (Ldlr)
   04979 Cholesterol metabolism
    101703463 (Ldlr)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101703463 (Ldlr)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101703463 (Ldlr)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101703463 (Ldlr)
Membrane trafficking [BR:hgl04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    101703463 (Ldlr)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF SGL EGF_CA EGF hEGF
Other DBs
NCBI-GeneID: 101703463
NCBI-ProteinID: XP_004865613
LinkDB
Position
Un
AA seq 864 aa
MQCAPRMRTAGPVLRYGALLLCLAAGAAEDKCARNEFQCWDGKCISYTWVCDGRAECQDG
SDESQETCMAATCKPGDFSCGGRLNRCIPSSWRCDGHEDCNNGADEQGCPTRTCPEDEFH
CQDGRCISQQFLCDGDRDCLDGSDEVTCSVTTCGPANFQCNSSACIPQLWACDGDSDCSD
GSDEWPQRCEGRDTSAAQGANGPCSSLEFHCRSGECIHSSWHCDGAHDCKDKSDEEDCVV
ATCRPDEFQCADGTCIHGSRQCDQEHDCRDQSDEVGCINVTLCEGPNKFKCHSGECITLD
KVCNAARDCRDWSDEPLKECGTNECLDNNGGCSHICKDLKIGYQCLCPSGFHLADQWQCK
DIDECQEPDTCSQLCVNLEGSYKCECEDGFQMDPSTKTCKAVGSVAYLFFTNRHEVRKMT
PDRSQYASLLSNLKYAVALDAEVASSRLYWSDLSHRKIYSTRISAAPGSAHDTVIDGDLQ
APDGLAVDWVHRNIYWTDSVPGTVSVADTRGVKRRTLFQRKGSKPRGIVVDPVHGFMYWT
DWGTPAKIEKGGLNGVDMYSLVTEDIEWPNGITLDLSSSRLYWVDSKLHSIFSINVNGRN
RKTILEDEKQLAHPFSLAIFEDKIFWTDIINEAIFSVNRLTGLDVHLVAENLSSPEDIVL
FHNVTQPKGVNWCERTALPNGGCQYLCLPAPQINSHSPKFTCVCPDGMVLAKDMRSCLTE
AEPSVTTPVHPTARPEASSTAVRPKHADQWPAPSTSGRPVATSGLTTAASVTMSHQVVGN
AAGRGEKPHSVGALTIVLPIGLVALLCLGAFLLWKNWRLKNINSINFDNPVYQKTTEDEV
HICRSQDGYIYPSRQRVSLEDDVV
NT seq 2595 nt   +upstreamnt  +downstreamnt
atgcagtgcgcgccgaggatgaggacggcgggcccggtgctgcgctacggtgcgctgctg
ctgtgcctggcggcgggggctgcagaagacaagtgtgcaagaaatgaattccagtgctgg
gatgggaagtgcatctcctacacgtgggtgtgtgatggcagggcggagtgccaggacggc
tctgacgagtcccaggaaacgtgcatggctgccacctgcaagccgggtgacttcagctgt
gggggccgcctgaaccgctgcatccccagctcctggaggtgtgacggccatgaggactgt
aacaacggcgccgatgagcaaggctgtcccaccaggacgtgtcccgaggacgagttccac
tgccaggatggccgctgcatctcgcagcagttcctctgcgatggtgaccgtgactgccta
gacggttcagacgaggtcacctgctcagtgaccacctgcggccctgccaacttccagtgc
aactcctcagcctgcatcccccagctgtgggcctgcgacggcgactccgactgcagtgac
ggctctgacgagtggccacagcgctgcgagggccgggacacgtcggctgcccagggggcc
aatggcccctgctcctccctggagttccactgccgcagcggcgagtgcatccacagcagc
tggcactgtgacggtgcccacgactgcaaggacaagtctgacgaggaggactgcgtggtg
gccacctgccgccccgatgagttccagtgtgctgacggcacctgtatccacggcagccgg
cagtgtgaccaagagcacgactgcagggaccagagcgacgaagtcggctgcatcaacgtg
acactctgcgagggtcccaacaagtttaagtgccacagcggcgagtgcatcacactggac
aaagtgtgcaacgcagccagggactgtcgcgactggtcggacgagcccctcaaggagtgt
gggaccaacgaatgcttggacaacaatgggggctgttcccatatctgcaaggacctcaag
atcggctaccagtgcttatgccccagtgggttccacctggcggaccagtggcagtgcaaa
gacattgatgagtgtcaggagcctgacacctgcagccagctgtgtgtgaacctggagggg
agctacaagtgtgagtgtgaggatggcttccagatggaccccagcacgaagacctgcaaa
gccgtcggctcagtcgcctacctgttcttcaccaaccgccacgaggtgcggaagatgacc
ccagaccgcagccagtatgccagcctcctctccaacctgaagtatgcggtggccctggac
gcggaggtggccagcagccggctctattggtcagacctgtcccacaggaagatctatagc
acccggatcagcgcagccccgggctctgcccacgacactgtcattgacggggatctccag
gcccccgacgggctggccgtggactgggtccaccgtaacatctactggaccgactctgtc
cccggtacggtgtctgtggccgacaccaggggcgtgaagaggaggactttgttccagagg
aaaggttccaagcccaggggcatcgtggtggaccctgtgcacggcttcatgtactggaca
gactggggaacccccgccaagatcgagaaagggggcctgaacggcgtggacatgtactcg
ctggtgacagaagacatcgagtggcccaatggcatcacactggatctctccagcagccgc
ctctactgggttgactccaaactccactccatcttcagtatcaatgtcaatggtagaaac
aggaagaccatcttggaggatgaaaagcagctggcccaccccttctccttggccatcttt
gaggacaaaatattttggacggatatcataaatgaagccattttcagtgtcaaccgcctc
acgggtttggatgttcatttagtggctgaaaacctgtcatcacctgaagacattgtcctg
tttcacaatgtcacacaaccgaaaggggtgaactggtgtgagaggacagccctccccaac
ggtggctgccagtacttgtgtctgcctgccccacagatcaactcccattcccccaagttc
acttgtgtgtgcccggatggtatggtgctagccaaggacatgaggagctgtctcacagag
gctgagccttctgtgacaactccagtgcaccctaccgccaggccagaagccagcagcaca
gctgtgaggccaaagcacgcagaccagtggcccgctcccagcacatctgggcggcctgtg
gccacctccgggctcaccacggcggcgtcggtgaccatgtcccaccaagtcgtgggcaac
gccgctggcagaggggaaaagcctcacagcgtgggggctctgaccatcgtccttcccatc
gggctggtcgctctcctctgccttggtgcctttctgctgtggaagaactggcggctcaag
aacatcaacagcatcaactttgacaaccccgtataccagaagaccacagaagacgaggtg
cacatctgccgcagccaggacggctacatctacccctcgaggcagagggtcagcctggag
gatgacgtggtgtga

DBGET integrated database retrieval system